Glucocorticoid Receptor DNA binding domain in complex with methylated precursor for a modern recognition element (methylated pre-GBS). Determined by X-ray diffraction at 2.0 Å resolution. Released 2 Jun 2021.
Explore 6X6E in 3D Show helices and sheets RCSB PDB PDBe
6X6E contains 7 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 420 | 1 | 1 |
| β-strand | 427 | 1 | 1 |
| α-helix | 428 | 1 | |
| β-strand | 430-432 | 3 | 2 |
| β-strand | 435-437 | 3 | 2 |
| α-helix | 439-450 | 12 | |
| α-helix | 474-484 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 420 | 1 | 3 |
| β-strand | 427 | 1 | 3 |
| α-helix | 428 | 1 | |
| β-strand | 430-432 | 3 | 4 |
| β-strand | 435-437 | 3 | 4 |
| α-helix | 439-449 | 11 | |
| α-helix | 469-471 | 3 | |
| α-helix | 474-483 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glucocorticoid receptor | A, B | protein | 75 | Homo sapiens | P04150 (AlphaFold model) |
| DNA (5'-D(*CP*CP*AP*GP*AP*AP*CP*GP*GP*AP*GP*(5CM)P*GP*TP*TP*CP*TP*G)-3') | C | DNA | 18 | Homo sapiens | |
| DNA (5'-D(*TP*CP*AP*GP*AP*AP*CP*GP*CP*TP*CP*(5CM)P*GP*TP*TP*CP*TP*G)-3') | D | DNA | 18 | Homo sapiens |
>6X6E_1 Glucocorticoid receptor (chains A, B) PPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPAC RYRKCLQAGMNLEAR
>6X6E_2 DNA (5'-D(*CP*CP*AP*GP*AP*AP*CP*GP*GP*AP*GP*(5CM)P*GP*TP*TP*CP*TP*G)-3') (chains C) CCAGAACGGAGCGTTCTG
>6X6E_3 DNA (5'-D(*TP*CP*AP*GP*AP*AP*CP*GP*CP*TP*CP*(5CM)P*GP*TP*TP*CP*TP*G)-3') (chains D) TCAGAACGCTCCGTTCTG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Structural basis for glucocorticoid receptor recognition of both unmodified and methylated binding sites, precursors of a modern recognition element. Liu, X., Weikum, E.R., Tilo, D. et al. Nucleic Acids Res (2021) 49:8923-8933. DOI 10.1093/nar/gkab605 · PubMed
Other PDB entries of the same protein (UniProt P04150 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6X6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.