5UC3: Glucocorticoid receptor

Structure of the dominant negative mutant Glucocorticoid Receptor alpha (L733K/N734P) complexed with RU-486. Determined by X-ray diffraction at 2.01 Å resolution. Released 27 Dec 2017.

Method: X-ray diffraction
Resolution: 2.01 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,023
Mol. weight: 61.73 kDa
Ligands: 486
Released: 27 Dec 2017

Explore 5UC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UC3 contains 22 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-539	8
α-helix	540-545	6
α-helix	556-580	25
α-helix	584-586	3
α-helix	589-615	27
β-strand	621-624	4	1
β-strand	627-629	3	1
α-helix	633-635	3
α-helix	640-656	17
α-helix	660-671	12
β-strand	674-676	3	2
α-helix	683-702	20
α-helix	708-739	32
α-helix	740-744	5
β-strand	769-771	3	2

Chain B: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	532-539	8
α-helix	540-545	6
α-helix	556-579	24
α-helix	584-586	3
α-helix	589-614	26
β-strand	621-624	4	3
β-strand	627-629	3	3
α-helix	631-634	4
α-helix	639-655	17
α-helix	660-671	12
β-strand	674-676	3	4
α-helix	683-702	20
α-helix	708-739	32
α-helix	740-744	5
β-strand	769-771	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucocorticoid receptor	A, B	protein	257	Homo sapiens	P04150 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UC3_1 Glucocorticoid receptor (chains A, B)
SPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKA
IPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMY
DQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKA
IVKREGNSSQNWQRFYQLTKLLDSMHEVVENLKPYCFQTFLDKTMSIEFPEMLAEIITNQ
IPKYSNGNIKKLLFHQK

Ligands and cofactors

ID	Name	Formula	Copies
486	11-(4-dimethylamino-phenyl)-17-hydroxy-13-methyl-17-prop-1-ynyl-1,2,6,7,8,11,12…	C29 H35 N O2	2

Water and common crystallization additives (MPD, EPE, EDO) are not listed.

Primary citation

Nuclear receptor. Min, J., Pedersen, L.C. To be published.

Other PDB entries of the same protein (UniProt P04150 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDD 1.8 Å, GR in complex with desisobutyrylciclesonide
5E69 1.85 Å, Glucocorticoid receptor DNA binding domain - IL8 NF-kB response element complex
4HN5 1.9 Å, GR DNA Binding Domain - TSLP nGRE Complex
4P6W 1.95 Å, Crystal Structure of mometasone furoate-bound glucocorticoid receptor ligand binding…
8A9G 1.96 Å, Binary complex of 14-3-3 zeta Glucocorticoid Receptor (GR) pT524 peptide stabilised by…
5CBY 2.0 Å, AncGR2 DNA Binding Domain - (+)GRE Complex
5CBX 2.0 Å, AncGR DNA Binding Domain - (+)GRE Complex
6X6E 2.0 Å, Glucocorticoid Receptor DNA binding domain in complex with methylated precursor for a…
6YMO 2.02 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pS617 peptide
6YO8 2.09 Å, Binary complex of 14-3-3 zeta with Glucocorticoid Receptor (GR) pT524 peptide
3K22 2.1 Å, Glucocorticoid Receptor with Bound alaninamide 10 with TIF2 peptide
5NFP 2.1 Å, Glucocorticoid Receptor in complex with budesonide

Browse structure collections

About this viewer

MolViewer shows 5UC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.