4UYI: BTB domain of human SLX4

Crystal structure of the BTB domain of human SLX4 (BTBD12). Determined by X-ray diffraction at 1.86 Å resolution. Released 1 Oct 2014.

Method: X-ray diffraction
Resolution: 1.86 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,071
Mol. weight: 16.74 kDa
Released: 1 Oct 2014

Explore 4UYI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4UYI contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	663-682	20
β-strand	693-696	4	1
β-strand	702-705	4	1
α-helix	707-713	7
α-helix	715-724	10
β-strand	726-730	5	1
β-strand	733-739	7	1
α-helix	745-757	13
α-helix	764-766	3
α-helix	767-776	10
α-helix	780-787	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Structure-specific endonuclease subunit SLX4	A	protein	152	HOMO SAPIENS	Q8IY92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4UYI_1 STRUCTURE-SPECIFIC ENDONUCLEASE SUBUNIT SLX4 (chains A)
MHHHHHHSSGVDLGTENLYFQSMGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLY
AHKFVLYARCPLLIQYVNNEGFSAIEDGVETQRVLLGDVSTEAARTFLHYLYTADTGLPP
GLSSELSSLAHRFGVSELVHLCEQVPIATDSE

Primary citation

Crystal Structure of the Btb Domain of Human Slx4 (Btbd12). Pinkas, D.M., Sanvitale, C.E., Strain-Damerell, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q8IY92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
4ZOU 2.15 Å, Crystal structure of the BTB domain of SLX4
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
7TUJ NMR solution structure of the phosphorylated MUS81-binding region from human SLX4

Browse structure collections

About this viewer

MolViewer shows 4UYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.