7TUJ: Structure-specific endonuclease subunit SLX4

NMR solution structure of the phosphorylated MUS81-binding region from human SLX4. Determined by solution NMR. Released 19 Oct 2022.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 692
Mol. weight: 9.96 kDa
Released: 19 Oct 2022

Explore 7TUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TUJ contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	1538-1539	2
α-helix	1566-1568	3
α-helix	1571-1580	10
α-helix	1588-1602	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Structure-specific endonuclease subunit SLX4	A	protein	86	Homo sapiens	Q8IY92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7TUJ_1 Structure-specific endonuclease subunit SLX4 (chains A)
AQMPSAGGAQKPEGLETPKGANRKKNLPPKVPITPMPQYSIMETPVLKKELDRFGVRPLP
KRQMVLKLKEIFQYTHQTLDSDSEDE

Primary citation

Phosphorylation of the DNA repair scaffold SLX4 drives folding of the SAP domain and activation of the MUS81-EME1 endonuclease. Payliss, B.J., Tse, Y.W.E., Reichheld, S.E. et al. Cell Rep (2022) 41:111537-111537. DOI 10.1016/j.celrep.2022.111537 · PubMed

Other PDB entries of the same protein (UniProt Q8IY92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
4UYI 1.86 Å, Crystal structure of the BTB domain of human SLX4 (BTBD12)
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
4ZOU 2.15 Å, Crystal structure of the BTB domain of SLX4
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex

Browse structure collections

About this viewer

MolViewer shows 7TUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.