4ZOU: BTB domain of SLX4

Crystal structure of the BTB domain of SLX4. Determined by X-ray diffraction at 2.15 Å resolution. Released 4 May 2016.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Homo sapiens
Chains: 1
Atoms: 938
Mol. weight: 13.02 kDa
Released: 4 May 2016

Explore 4ZOU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZOU contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	670-682	13
β-strand	693-696	4	1
β-strand	702-705	4	1
α-helix	707-713	7
α-helix	715-724	10
β-strand	726-730	5	1
β-strand	733-739	7	1
α-helix	745-757	13
α-helix	767-776	10
α-helix	780-786	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Structure-specific endonuclease subunit SLX4	A	protein	119	Homo sapiens	Q8IY92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZOU_1 Structure-specific endonuclease subunit SLX4 (chains A)
RTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLYAHKFVLYARCPLLIQYVNNEGFSA
VEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCE

Primary citation

The BTB domain is both a structural and functional pivot of the SLX4-nuclease complex. Wan, B., Chen, Y., Wu, J. et al. To be published.

Other PDB entries of the same protein (UniProt Q8IY92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7BU5 1.8 Å, Crystal Structure of Human SLX4 and MUS81
4UYI 1.86 Å, Crystal structure of the BTB domain of human SLX4 (BTBD12)
4M7C 2.05 Å, Crystal structure of the TRF2-binding motif of SLX4 in complex with the TRFH domain of…
9QED 3.2 Å, Cryo-EM structure of the XPF-ERCC1-SLX4(330-555)-SLX4IP complex
9QEE 3.4 Å, Cryo-EM structure of a DNA-bound XPF-ERCC1-SLX4(330-555)-SLX4IP complex
7TUJ NMR solution structure of the phosphorylated MUS81-binding region from human SLX4

Browse structure collections

About this viewer

MolViewer shows 4ZOU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.