7BU5: Human SLX4 and MUS81

Crystal Structure of Human SLX4 and MUS81. Determined by X-ray diffraction at 1.8 Å resolution. Released 7 Apr 2021.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,218
Mol. weight: 18.78 kDa
Ligands: GLY
Released: 7 Apr 2021

Explore 7BU5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7BU5 contains 10 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	1
α-helix	19-34	16
α-helix	40-50	11
α-helix	56-57	2
α-helix	62-65	4
β-strand	66	1	2
α-helix	71-86	16

Chain B: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	1560-1562	3	1
α-helix	1563-1564	2
α-helix	1566-1568	3
α-helix	1571-1579	9
β-strand	1583	1	2
α-helix	1584-1585	2
α-helix	1588-1602	15
β-strand	1603-1605	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MUS81 endonuclease homolog (Yeast), isoform CRA_b	A	protein	98	Homo sapiens	Q96NY9 (AlphaFold model)
Structure-specific endonuclease subunit SLX4	B	protein	61	Homo sapiens	Q8IY92 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7BU5_1 MUS81 endonuclease homolog (Yeast), isoform CRA_b (chains A)
AAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRHRTRFVFQKALRSLRRYPLPLRSGK
EAKILQHFGDGLCRMLDERLQRHRTSGGDHAPDSPSGE

Sequence of entity 2 (B), FASTA

>7BU5_2 Structure-specific endonuclease subunit SLX4 (chains B)
RKKNLPPKVPITPMPQYSIMETPVLKKELDRFGVRPLPKRQMVLKLKEIFQYTHQTLDSD
S

Ligands and cofactors

ID	Name	Formula	Copies
GLY	Glycine	C2 H5 N O2	2

Primary citation

SLX4 control MUS81 endonuclease function in telomere through an intermolecular SAP domain. Wan, B., Wu, J., Lei, M. To be published.

Other PDB entries of the same protein (UniProt Q96NY9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F9L 2.02 Å, Crystal structure of MUS81-EME1 bound by compound 16.
9F98 2.15 Å, Crystal structure of MUS81-EME1, apo form.
9F9M 2.47 Å, Crystal structure of MUS81-EME1 bound by compound 21.
9F9K 2.73 Å, Crystal structure of MUS81-EME1 bound by compound 15.
4P0P 2.8 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA, and Mg2+
9F99 2.8 Å, Crystal structure of MUS81-EME1 bound by compound 10.
4P0Q 2.85 Å, Crystal structure of Human Mus81-Eme1 in complex with 5'-flap DNA
9F9A 2.91 Å, Crystal structure of MUS81-EME1 bound by compound 12.
7F6L 3.2 Å, Crystal structure of human MUS81-EME2 complex
2ZIX 3.5 Å, Crystal structure of the Mus81-Eme1 complex
4P0S 6.0 Å, human Mus81-Eme1-3'flap DNA complex
4P0R 6.5 Å, human Mus81-Eme1-3'flap DNA complex

Browse structure collections

About this viewer

MolViewer shows 7BU5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.