Crystal structure of the BTB domain of human SLX4 (BTBD12). Determined by X-ray diffraction at 1.86 Å resolution. Released 1 Oct 2014.
Explore 4UYI in 3D Show helices and sheets RCSB PDB PDBe
4UYI contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 663-682 | 20 | |
| β-strand | 693-696 | 4 | 1 |
| β-strand | 702-705 | 4 | 1 |
| α-helix | 707-713 | 7 | |
| α-helix | 715-724 | 10 | |
| β-strand | 726-730 | 5 | 1 |
| β-strand | 733-739 | 7 | 1 |
| α-helix | 745-757 | 13 | |
| α-helix | 764-766 | 3 | |
| α-helix | 767-776 | 10 | |
| α-helix | 780-787 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Structure-specific endonuclease subunit SLX4 | A | protein | 152 | HOMO SAPIENS | Q8IY92 (AlphaFold model) |
>4UYI_1 STRUCTURE-SPECIFIC ENDONUCLEASE SUBUNIT SLX4 (chains A) MHHHHHHSSGVDLGTENLYFQSMGRTLLSLGLLVADFGAMVNNPHLSDVQFQTDSGEVLY AHKFVLYARCPLLIQYVNNEGFSAIEDGVETQRVLLGDVSTEAARTFLHYLYTADTGLPP GLSSELSSLAHRFGVSELVHLCEQVPIATDSE
Crystal Structure of the Btb Domain of Human Slx4 (Btbd12). Pinkas, D.M., Sanvitale, C.E., Strain-Damerell, C. et al. To be published.
Other PDB entries of the same protein (UniProt Q8IY92 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4UYI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.