4XHL: S. cerevisiae Hrr25 1-394

Structure of S. cerevisiae Hrr25 1-394 (K38R mutant). Determined by X-ray diffraction at 3.01 Å resolution. Released 6 Jan 2016.

Method: X-ray diffraction
Resolution: 3.01 Å
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 2,811
Mol. weight: 46.89 kDa
Ligands: CKI
Released: 6 Jan 2016

Explore 4XHL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4XHL contains 21 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	10-14	5	1
β-strand	23-27	5	1
β-strand	34-39	6	1
α-helix	49-59	11
β-strand	68-74	7	1
β-strand	77-83	7	1
β-strand	88	1	2
α-helix	89-95	7
α-helix	102-121	20
β-strand	124-125	2	3
α-helix	131-133	3
β-strand	134-135	2	2
α-helix	140-142	3
β-strand	146-147	2	2
β-strand	154-155	2	3
β-strand	157	1	4
α-helix	163	1
β-strand	164	1	4
α-helix	165-167	3
α-helix	171-173	3
α-helix	177-179	3
α-helix	182-185	4
α-helix	188-190	3
α-helix	192-207	16
α-helix	221-234	14
α-helix	237-240	4
α-helix	246-256	11
α-helix	262-264	3
α-helix	266-279	14
α-helix	289-298	10
α-helix	334-343	10
α-helix	361-364	4
α-helix	366-370	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Casein kinase I homolog HRR25	A	protein	394	Saccharomyces cerevisiae	P29295 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4XHL_1 Casein kinase I homolog HRR25 (chains A)
MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIRLESIRSRHPQLDYESRVYRYLS
GGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYIH
GRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARYA
SVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVETL
CSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTMLRYTKAMV
EKQRDLLIEKGDLNANSNAASASNSTDNKSETFNKIKLLAMKKFPTHFHYYKNEDKHNPS
PEEIKQQTILNNNAASSLPEELLNALDKGMENLR

Ligands and cofactors

ID	Name	Formula	Copies
CKI	N-(2-aminoethyl)-5-chloroisoquinoline-8-sulfonamide	C11 H12 Cl N3 O2 S	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of the Saccharomyces cerevisiae Hrr25:Mam1 monopolin subcomplex reveals a novel kinase regulator. Ye, Q., Ur, S.N., Su, T.Y. et al. EMBO J (2016) 35:2139-2151. DOI 10.15252/embj.201694082 · PubMed

Other PDB entries of the same protein (UniProt P29295 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CYZ 1.84 Å, Structure of S. cerevisiae Hrr25:Mam1 complex, form 1
5CZO 2.89 Å, Structure of S. cerevisiae Hrr25:Mam1 complex, form 2

Browse structure collections

About this viewer

MolViewer shows 4XHL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.