5CZO: S. cerevisiae Hrr25:Mam1 complex, form 2

Structure of S. cerevisiae Hrr25:Mam1 complex, form 2. Determined by X-ray diffraction at 2.89 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 2.89 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 4
Atoms: 7,958
Mol. weight: 118.38 kDa
Ligands: ZN
Released: 3 Aug 2016

Explore 5CZO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CZO contains 60 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-16	8	1
β-strand	21-28	8	1
β-strand	34-41	8	1
α-helix	49-58	10
α-helix	66-67	2
β-strand	68-74	7	1
β-strand	77-83	7	1
β-strand	85-88	4	2
α-helix	89-95	7
α-helix	102-120	19
β-strand	124-125	2	3
α-helix	131-133	3
β-strand	134-137	4	2
α-helix	139-141	3
β-strand	145-147	3	2
β-strand	154-155	2	3
β-strand	157	1	4
α-helix	163	1
β-strand	164	1	4
α-helix	165-167	3
α-helix	182-185	4
α-helix	188-190	3
α-helix	192-208	17
α-helix	221-234	14
α-helix	237-240	4
α-helix	246-256	11
α-helix	262-264	3
α-helix	266-279	14
α-helix	289-309	21
α-helix	327-343	17
α-helix	361-372	12
α-helix	380-387	8

Chain B: 21 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	6
β-strand	9-18	10	6
β-strand	21-28	8	6
β-strand	34-41	8	6
α-helix	49-58	10
β-strand	68-74	7	6
β-strand	77-83	7	6
β-strand	85-88	4	7
α-helix	89-95	7
α-helix	102-121	20
β-strand	124-125	2	8
α-helix	131-133	3
β-strand	134-137	4	7
α-helix	139-141	3
β-strand	145-147	3	7
β-strand	154-155	2	8
β-strand	157	1	9
α-helix	163	1
β-strand	164	1	9
α-helix	165-167	3
α-helix	171-173	3
α-helix	182-185	4
α-helix	188-190	3
α-helix	192-208	17
α-helix	225-234	10
α-helix	237-240	4
α-helix	246-257	12
α-helix	262-264	3
α-helix	266-279	14
α-helix	289-310	22
α-helix	328-343	16
α-helix	361-364	4
α-helix	366-372	7
α-helix	380-386	7

Chain C: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	94-110	17
α-helix	121-125	5
α-helix	130-131	2
α-helix	132-137	6
β-strand	141	1	5
α-helix	148	1
α-helix	149-158	10
α-helix	159-161	3
α-helix	180-181	2
α-helix	184-186	3
β-strand	188	1	5
α-helix	189-190	2

Chain D: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	94-110	17
α-helix	121-126	6
α-helix	130-134	5
α-helix	137-139	3
β-strand	141	1	10
α-helix	148	1
α-helix	149-158	10
α-helix	159-161	3
α-helix	184-186	3
β-strand	188	1	10
α-helix	189-190	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Casein kinase I homolog HRR25	A, B	protein	395	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P29295 (AlphaFold model)
Monopolin complex subunit MAM1	C, D	protein	105	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P40065 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5CZO_1 Casein kinase I homolog HRR25 (chains A, B)
AMDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIRLESIRSRHPQLDYESRVYRYL
SGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYI
HGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARY
ASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVET
LCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTMLRYTKAM
VEKQRDLLIEKGDLNANSNAASASNSTDNKSETFNKIKLLAMKKFPTHFHYYKNEDKHNP
SPEEIKQQTILNNNAASSLPEELLNALDKGMENLR

Sequence of entity 2 (C, D), FASTA

>5CZO_2 Monopolin complex subunit MAM1 (chains C, D)
EATECLTRSNLKKLQEKIFDRELNDIACDHCLCSTENRRDIKYSRLWFLFELEMSENWNE
NLRLSCYNKYVYSAIDESWKMENILLKEQEKHYEYFPIGQLLIPN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure of the Saccharomyces cerevisiae Hrr25:Mam1 monopolin subcomplex reveals a novel kinase regulator. Ye, Q., Ur, S.N., Su, T.Y. et al. EMBO J (2016) 35:2139-2151. DOI 10.15252/embj.201694082 · PubMed

Other PDB entries of the same protein (UniProt P29295 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CYZ 1.84 Å, Structure of S. cerevisiae Hrr25:Mam1 complex, form 1
4XHL 3.01 Å, Structure of S. cerevisiae Hrr25 1-394 (K38R mutant)

Browse structure collections

About this viewer

MolViewer shows 5CZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.