5CYZ: S. cerevisiae Hrr25:Mam1 complex, form 1

Structure of S. cerevisiae Hrr25:Mam1 complex, form 1. Determined by X-ray diffraction at 1.84 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.84 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 4,308
Mol. weight: 59.41 kDa
Ligands: ZN
Released: 3 Aug 2016

Explore 5CYZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CYZ contains 31 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	9-17	9	1
β-strand	22-28	7	1
β-strand	34-41	8	1
α-helix	49-58	10
α-helix	65-67	3
β-strand	68-74	7	1
β-strand	77-83	7	1
β-strand	85-88	4	2
α-helix	89-95	7
α-helix	102-121	20
β-strand	124-125	2	3
α-helix	131-133	3
β-strand	134-137	4	2
α-helix	139-141	3
β-strand	145-147	3	2
β-strand	154-155	2	3
β-strand	157	1	4
α-helix	163	1
β-strand	164	1	4
α-helix	165-167	3
α-helix	177-179	3
α-helix	182-185	4
α-helix	188-190	3
α-helix	192-208	17
α-helix	221-234	14
α-helix	237-240	4
α-helix	246-257	12
α-helix	262-264	3
α-helix	266-279	14
α-helix	289-307	19
α-helix	330-343	14
α-helix	361-364	4
α-helix	366-373	8
α-helix	379-386	8

Chain C: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	94-110	17
α-helix	121-126	6
α-helix	130-134	5
α-helix	137-139	3
β-strand	141	1	5
α-helix	148	1
α-helix	149-158	10
α-helix	159-161	3
α-helix	170-172	3
α-helix	184-187	4
β-strand	188	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Casein kinase I homolog HRR25	A	protein	395	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P29295 (AlphaFold model)
Monopolin complex subunit MAM1	C	protein	105	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P40065 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5CYZ_1 Casein kinase I homolog HRR25 (chains A)
AMDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIRLESIRSRHPQLDYESRVYRYL
SGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRRFSFKTVIMLALQMFCRIQYI
HGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFNTHRHIPYRENKSLTGTARY
ASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKATTKKQKYDRIMEKKLNVSVET
LCSGLPLEFQEYMAYCKNLKFDEKPDYLFLARLFKDLSIKLEYHNDHLFDWTMLRYTKAM
VEKQRDLLIEKGDLNANSNAASASNSTDNKSETFNKIKLLAMKKFPTHFHYYKNEDKHNP
SPEEIKQQTILNNNAASSLPEELLNALDKGMENLR

Sequence of entity 2 (C), FASTA

>5CYZ_2 Monopolin complex subunit MAM1 (chains C)
EATECLTRSNLKKLQEKIFDRELNDIACDHCLCSTENRRDIKYSRLWFLFELEMSENWNE
NLRLSCYNKYVYSAIDESWKMENILLKEQEKHYEYFPIGQLLIPN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Structure of the Saccharomyces cerevisiae Hrr25:Mam1 monopolin subcomplex reveals a novel kinase regulator. Ye, Q., Ur, S.N., Su, T.Y. et al. EMBO J (2016) 35:2139-2151. DOI 10.15252/embj.201694082 · PubMed

Other PDB entries of the same protein (UniProt P29295 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CZO 2.89 Å, Structure of S. cerevisiae Hrr25:Mam1 complex, form 2
4XHL 3.01 Å, Structure of S. cerevisiae Hrr25 1-394 (K38R mutant)

Browse structure collections

About this viewer

MolViewer shows 5CYZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.