Structural characterization of a synaptic adhesion complex. Determined by X-ray diffraction at 3.19 Å resolution. Released 19 Aug 2015.
Explore 4YEB in 3D Show helices and sheets RCSB PDB PDBe
4YEB contains 12 α-helices and 49 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 201-203 | 3 | |
| β-strand | 206-218 | 13 | 1 |
| β-strand | 224-227 | 4 | 2 |
| β-strand | 237-241 | 5 | 2 |
| β-strand | 249-253 | 5 | 2 |
| α-helix | 256-261 | 6 | |
| β-strand | 266-269 | 4 | 2 |
| α-helix | 273 | 1 | |
| β-strand | 274 | 1 | 3 |
| α-helix | 275 | 1 | |
| β-strand | 280-282 | 3 | 4 |
| β-strand | 285-289 | 5 | 4 |
| β-strand | 290 | 1 | 3 |
| β-strand | 295-300 | 6 | 4 |
| β-strand | 305-311 | 7 | 4 |
| β-strand | 323 | 1 | 5 |
| β-strand | 326 | 1 | 5 |
| β-strand | 332-336 | 5 | 6 |
| β-strand | 339-345 | 7 | 6 |
| β-strand | 352-358 | 7 | 6 |
| β-strand | 365-374 | 10 | 6 |
| β-strand | 380-383 | 4 | 7 |
| β-strand | 387-392 | 6 | 7 |
| β-strand | 406-412 | 7 | 7 |
| β-strand | 418-424 | 7 | 7 |
| β-strand | 432-434 | 3 | 1 |
| β-strand | 437-438 | 2 | 1 |
| β-strand | 443-448 | 6 | 1 |
| β-strand | 451-460 | 10 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-38 | 3 | 8 |
| β-strand | 41-43 | 3 | 8 |
| α-helix | 52-53 | 2 | |
| β-strand | 62-64 | 3 | 8 |
| β-strand | 87-89 | 3 | 8 |
| β-strand | 96 | 1 | 9 |
| β-strand | 108-110 | 3 | 8 |
| β-strand | 115 | 1 | 9 |
| β-strand | 119 | 1 | 10 |
| α-helix | 121-125 | 5 | |
| β-strand | 132-134 | 3 | 8 |
| β-strand | 145 | 1 | 10 |
| α-helix | 146 | 1 | |
| β-strand | 158-160 | 3 | 8 |
| β-strand | 168 | 1 | 11 |
| α-helix | 173-174 | 2 | |
| β-strand | 179-181 | 3 | 8 |
| β-strand | 189 | 1 | 11 |
| β-strand | 190 | 1 | 12 |
| α-helix | 192-195 | 4 | |
| β-strand | 203-205 | 3 | 8 |
| β-strand | 216 | 1 | 12 |
| β-strand | 229-231 | 3 | 8 |
| β-strand | 251-253 | 3 | 8 |
| β-strand | 257 | 1 | 13 |
| α-helix | 264-267 | 4 | |
| β-strand | 275-277 | 3 | 8 |
| β-strand | 281 | 1 | 13 |
| β-strand | 299-301 | 3 | 8 |
| α-helix | 314-319 | 6 | |
| α-helix | 322 | 1 | |
| β-strand | 329-330 | 2 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Latrophilin-3 | A | protein | 321 | Mus musculus | Q80TS3 (AlphaFold model) |
| Fibronectin leucine rich transmembrane protein 3 | B | protein | 370 | Mus musculus | Q8BGT1 (AlphaFold model) |
>4YEB_1 Latrophilin-3 (chains A) APSTDHLDYKDDDDKAAAKVFLCPGLLKGVYQSEHLFESDHQSGAWCKDPLQASDKIYYM PWTPYRTDTLTEYSSKDDFIAGRPTTTYKLPHRVDGTGFVVYDGALFFNKERTRNIVKFD LRTRIKSGEAIIANANYHDTSPYRWGGKSDIDLAVDENGLWVIYATEQNNGKIVISQLNP YTLRIEGTWDTAYDKRSASNAFMICGILYVVKSVYEDDDNEATGNKIDYIYNTDQSKDSL VDVPFPNSYQYIAAVDYNPRDNLLYVWNNYHVVKYSLDFGPLDSRSGPVHHGQVSYISPP IHLDSELERPPVRGILEVLFQ
>4YEB_2 Fibronectin leucine rich transmembrane protein 3 (chains B) APSTDPKSCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNL LKVQRIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSA VSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLK RLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRV PPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQS LPVKVNVRGLMCQAPEKVRGMAIKDLSAELFDCKDSGIVSTIQITTAIPNTAYPAQGQWP APVTLEVLFQ
Structural and Mechanistic Insights into the Latrophilin3-FLRT3 Complex that Mediates Glutamatergic Synapse Development. Ranaivoson, F.M., Liu, Q., Martini, F. et al. Structure (2015) 23:1665-1677. DOI 10.1016/j.str.2015.06.022 · PubMed
Other PDB entries of the same protein (UniProt Q80TS3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4YEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.