Phenolic acid derivative bound to influenza strain H1N1 polymerase subunit PA endonuclease. Determined by X-ray diffraction at 1.91 Å resolution. Released 29 Apr 2015.
Explore 4YYL in 3D Show helices and sheets RCSB PDB PDBe
4YYL contains 9 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-8 | 8 | |
| α-helix | 11-23 | 13 | |
| α-helix | 32-50 | 19 | |
| β-strand | 76-78 | 3 | 1 |
| α-helix | 84-98 | 15 | |
| α-helix | 100-103 | 4 | |
| β-strand | 109-111 | 3 | 1 |
| β-strand | 116-123 | 8 | 1 |
| α-helix | 127-138 | 12 | |
| β-strand | 144-149 | 6 | 1 |
| β-strand | 154-156 | 3 | 1 |
| α-helix | 157-159 | 3 | |
| α-helix | 165-184 | 20 | |
| α-helix | 188-194 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polymerase acidic protein | A | protein | 191 | Influenza A virus (strain A/Puerto Rico/8/1934 H1N1) | P03433 (AlphaFold model) |
>4YYL_1 Polymerase acidic protein (chains A) GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHR FEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKA NKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSE RGAAELALVPR
| ID | Name | Formula | Copies |
|---|---|---|---|
| 4KN | 2-(4-fluorophenoxy)-1-(2,3,4-trihydroxyphenyl)ethanone | C14 H11 F O5 | 3 |
| MN | Manganese (II) ion | Mn | 2 |
Water and common crystallization additives (SO4) are not listed.
Structural and computational study on inhibitory compounds for endonuclease activity of influenza virus polymerase. Fudo, S., Yamamoto, N., Nukaga, M. et al. Bioorg Med Chem (2015) 23:5466-5475. DOI 10.1016/j.bmc.2015.07.046 · PubMed
Other PDB entries of the same protein (UniProt P03433 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4YYL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.