4Z6Y: TBC1D7-TSC1 complex
Structure of the TBC1D7-TSC1 complex. Determined by X-ray diffraction at 2.81 Å resolution. Released 20 Apr 2016.
- Method
- X-ray diffraction
- Resolution
- 2.81 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 10,471
- Mol. weight
- 152.03 kDa
- Released
- 20 Apr 2016
Explore 4Z6Y in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4Z6Y contains 90 α-helices and 12 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 21 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-32 | 8 | |
| β-strand | 36 | 1 | 5 |
| α-helix | 39-48 | 10 | |
| α-helix | 50-52 | 3 | |
| α-helix | 53-55 | 3 | |
| α-helix | 56-63 | 8 | |
| β-strand | 70 | 1 | 5 |
| α-helix | 71-73 | 3 | |
| α-helix | 74-94 | 21 | |
| α-helix | 104-115 | 12 | |
| α-helix | 126-128 | 3 | |
| α-helix | 129-144 | 16 | |
| α-helix | 148-163 | 16 | |
| α-helix | 170-172 | 3 | |
| α-helix | 173-184 | 12 | |
| α-helix | 186-194 | 9 | |
| α-helix | 198-200 | 3 | |
| α-helix | 203-207 | 5 | |
| β-strand | 212 | 1 | 6 |
| β-strand | 215 | 1 | 6 |
| α-helix | 217-228 | 12 | |
| α-helix | 234-245 | 12 | |
| α-helix | 247-251 | 5 | |
| α-helix | 256-264 | 9 | |
| α-helix | 271-286 | 16 | |
Chain B: 20 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 24-32 | 9 | |
| β-strand | 36 | 1 | 1 |
| α-helix | 39-48 | 10 | |
| α-helix | 50-52 | 3 | |
| α-helix | 53-55 | 3 | |
| α-helix | 56-63 | 8 | |
| β-strand | 70 | 1 | 1 |
| α-helix | 73-94 | 22 | |
| α-helix | 104-115 | 12 | |
| α-helix | 126-128 | 3 | |
| α-helix | 129-144 | 16 | |
| α-helix | 148-163 | 16 | |
| α-helix | 170-172 | 3 | |
| α-helix | 173-184 | 12 | |
| α-helix | 186-194 | 9 | |
| α-helix | 198-200 | 3 | |
| α-helix | 203-207 | 5 | |
| α-helix | 217-228 | 12 | |
| α-helix | 234-245 | 12 | |
| α-helix | 247-251 | 5 | |
| α-helix | 256-264 | 9 | |
| α-helix | 271-286 | 16 | |
Chains C and D: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 941-971 | 31 | |
| α-helix | 975-991 | 17 | |
Chain E: 19 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-32 | 8 | |
| β-strand | 36 | 1 | 4 |
| α-helix | 39-48 | 10 | |
| α-helix | 50-52 | 3 | |
| α-helix | 53-63 | 11 | |
| β-strand | 70 | 1 | 4 |
| α-helix | 73-94 | 22 | |
| α-helix | 104-114 | 11 | |
| α-helix | 126-128 | 3 | |
| α-helix | 129-144 | 16 | |
| α-helix | 148-163 | 16 | |
| α-helix | 170-172 | 3 | |
| α-helix | 173-184 | 12 | |
| α-helix | 186-194 | 9 | |
| α-helix | 198-200 | 3 | |
| α-helix | 203-207 | 5 | |
| α-helix | 217-228 | 12 | |
| α-helix | 234-245 | 12 | |
| α-helix | 247-251 | 5 | |
| α-helix | 256-264 | 9 | |
| α-helix | 271-286 | 16 | |
Chain F: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 941-971 | 31 | |
| α-helix | 975-984 | 10 | |
| α-helix | 986-991 | 6 | |
Chain G: 21 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-32 | 8 | |
| β-strand | 36 | 1 | 2 |
| α-helix | 39-48 | 10 | |
| α-helix | 50-52 | 3 | |
| α-helix | 53-55 | 3 | |
| α-helix | 56-63 | 8 | |
| β-strand | 70 | 1 | 2 |
| α-helix | 71-73 | 3 | |
| α-helix | 74-95 | 22 | |
| α-helix | 104-115 | 12 | |
| α-helix | 126-128 | 3 | |
| α-helix | 129-144 | 16 | |
| α-helix | 148-163 | 16 | |
| α-helix | 170-172 | 3 | |
| α-helix | 173-184 | 12 | |
| α-helix | 186-194 | 9 | |
| α-helix | 198-200 | 3 | |
| α-helix | 203-207 | 5 | |
| β-strand | 212 | 1 | 3 |
| β-strand | 215 | 1 | 3 |
| α-helix | 217-228 | 12 | |
| α-helix | 234-245 | 12 | |
| α-helix | 247-251 | 5 | |
| α-helix | 256-264 | 9 | |
| α-helix | 271-286 | 16 | |
Chain H: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 939-971 | 33 | |
| α-helix | 977-991 | 15 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| TBC1 domain family member 7 | A, B, E, G | protein | 273 | Homo sapiens | Q9P0N9 (AlphaFold model) |
| Hamartin | C, D, F, H | protein | 56 | Homo sapiens | Q92574 (AlphaFold model) |
Sequence of entity 1 (A, B, E, G), FASTA
>4Z6Y_1 TBC1 domain family member 7 (chains A, B, E, G)
GVEEKKSLEILLKDDRLDTEKLCTFSQRFPLPSMYRALVWKVLLGILPPHHESHAKVMMY
RKEQYLDVLHALKVVRFVSDATPQAEVYLRMYQLESGKLPRSPSFPLEPDDEVFLAIAKA
MEEMVEDSVDCYWITRRFVNQLNTKYRDSLPQLPKAFEQYLNLEDGRLLTHLRMCSAAPK
LPYDLWFKRCFAGCLPESSLQRVWDKVVSGSCKILVFVAVEILLTFKIKVMALNSAEKIT
KFLENIPQDSSDAIVSKAIDLWHKHCGTPVHSS
Sequence of entity 2 (C, D, F, H), FASTA
>4Z6Y_2 Hamartin (chains C, D, F, H)
RGQLQAAESRYEAQKRITQVFELEILDLYGRLEKDGLLKKLEEEKAEAAEAAEERL
Primary citation
Structure of the TBC1D7-TSC1 complex. Gai, Z., Wu, G. To be published.
Other PDB entries of the same protein (UniProt Q9P0N9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3QWL 1.9 Å, Crystal structure of human TBC1 domain family member 7
- 5ULO 2.14 Å, Crystal Structure of 14-3-3 zeta in Complex with a Serine 124-phosphorylated TBC1D7…
- 9CE3 2.9 Å, Structure of the TSC:WIPI3 lysosomal recruitment complex
- 5EJC 3.1 Å, Crystal structural of the TSC1-TBC1D7 complex
- 7DL2 4.4 Å, Cryo-EM structure of human TSC complex
Browse structure collections
About this viewer
MolViewer shows 4Z6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.