Leiomodin-1 Actin-Binding Site 2 (ABS2). Determined by X-ray diffraction at 1.54 Å resolution. Released 21 Oct 2015.
Explore 4Z79 in 3D Show helices and sheets RCSB PDB PDBe
4Z79 contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 319-326 | 8 | |
| β-strand | 334-336 | 3 | 1 |
| α-helix | 345-355 | 11 | |
| β-strand | 363-365 | 3 | 1 |
| α-helix | 373-385 | 13 | |
| β-strand | 391-393 | 3 | 1 |
| α-helix | 401-410 | 10 | |
| α-helix | 411-413 | 3 | |
| β-strand | 419-421 | 3 | 1 |
| α-helix | 431-441 | 11 | |
| β-strand | 449-451 | 3 | 1 |
| α-helix | 457-484 | 28 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Leiomodin-1 Actin-Binding Site 2 (ABS2) | A | protein | 188 | Homo sapiens | P29536 (AlphaFold model) |
>4Z79_1 Leiomodin-1 Actin-Binding Site 2 (ABS2) (chains A) PTKPSEGPAKVEEEAAPSIFDEPLERVKNNDPEMTEVNVNNSDCITNEILVRFTEALEFN TVVKLFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNNTLT ELRFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQRQKR LQEQRQAQ
How Leiomodin and Tropomodulin use a common fold for different actin assembly functions. Boczkowska, M., Rebowski, G., Kremneva, E. et al. Nat Commun (2015) 6:8314-8314. DOI 10.1038/ncomms9314 · PubMed
Other PDB entries of the same protein (UniProt P29536 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4Z79 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.