4Z8G: Tropomodulin-1, Leiomodin-1 chimera

Chimera of Tropomodulin-1 and Leiomodin-1 Actin-Binding Site 2 (TL1 ABS2). Determined by X-ray diffraction at 2.1 Å resolution. Released 21 Oct 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,547
Mol. weight: 22.32 kDa
Ligands: NI
Released: 21 Oct 2015

Explore 4Z8G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z8G contains 6 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	180-191	12
β-strand	199-201	3	1
α-helix	210-220	11
β-strand	228-365	3	1
α-helix	373-385	13
β-strand	391-393	3	1
α-helix	401-411	11
β-strand	419-421	3	1
α-helix	431-442	12
β-strand	449-451	3	1
α-helix	457-484	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tropomodulin-1, Leiomodin-1 chimera (TP1 ABS2)	A	protein	191	Homo sapiens	P28289 (AlphaFold model), P29536 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4Z8G_1 Tropomodulin-1, Leiomodin-1 chimera (TP1 ABS2) (chains A)
MASVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEAL
KENSYVKKFALANTRADDHVAFAIAIMLKANKTITSLNLDSNHITGKGILAIFRALLQNN
TLTELRFHNQRHICGGKTEMEIAKLLKENTTLLKLGYHFELAGPRMTVTNLLSRNMDKQR
QKRLQEQRQAQ

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	9

Primary citation

How Leiomodin and Tropomodulin use a common fold for different actin assembly functions. Boczkowska, M., Rebowski, G., Kremneva, E. et al. Nat Commun (2015) 6:8314-8314. DOI 10.1038/ncomms9314 · PubMed

Other PDB entries of the same protein (UniProt P28289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4PKG 1.8 Å, Complex of ATP-actin With the N-terminal Actin-Binding Domain of Tropomodulin
4PKH 2.15 Å, Complex of ADP-actin With the N-terminal Actin-Binding Domain of Tropomodulin
4PKI 2.3 Å, Complex of ATP-actin With the C-terminal Actin-Binding Domain of Tropomodulin
4Z94 2.4 Å, Actin Complex With a Chimera of Tropomodulin-1 and Leiomodin-1 Actin-Binding Site 2
8F8T 3.26 Å, Cryo-EM structure of the Tropomodulin-capped pointed end of F-actin

Browse structure collections

About this viewer

MolViewer shows 4Z8G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.