4Z8J: SNX27 PDZ domain

Crystal structure of the SNX27 PDZ domain bound to the C-terminal PTHR PDZ binding motif. Determined by X-ray diffraction at 0.95 Å resolution. Released 24 Feb 2016.

Method: X-ray diffraction
Resolution: 0.95 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 1,003
Mol. weight: 11.62 kDa
Released: 24 Feb 2016

Explore 4Z8J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4Z8J contains 4 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	40-45	6	1
α-helix	46	1
β-strand	47	1	2
β-strand	50	1	2
β-strand	53-58	6	1
β-strand	66-68	3	3
β-strand	71-73	3	3
β-strand	78-82	5	1
α-helix	87-91	5
α-helix	97	1
β-strand	98-102	5	1
β-strand	105-106	2	1
α-helix	112-119	8
β-strand	125-131	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	588-592	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27	A	protein	101	Rattus norvegicus	Q8K4V4 (AlphaFold model)
C-terminal PDZ binding motif from parathyroid hormone receptor (PTHR)	B	protein	8	Homo sapiens	Q03431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4Z8J_1 Sorting nexin-27 (chains A)
GSHGGSPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAG
VRKGDRILEVNGVNVEGATHKQVVDLIRAGEKELILTVLSV

Sequence of entity 2 (B), FASTA

>4Z8J_2 C-terminal PDZ binding motif from parathyroid hormone receptor (PTHR) (chains B)
QEEWETVM

Primary citation

Role of SNX27-retromer in PTHR trafficking. Clairfeuille, T., Teasdale, R.D., Collins, B.M. et al. To be published.

Other PDB entries of the same protein (UniProt Q8K4V4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EMB 0.85 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal phosphorylated PTHR…
5ELQ 1.1 Å, Crystal structure of the SNX27 PDZ domain bound to the C-terminal DGKzeta PDZ binding…
5EMA 1.32 Å, Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal LRRC3B…
5EM9 1.6 Å, Crystal structure of the SNX27 PDZ domain bound to the phosphorylated C-terminal…
3QE1 1.68 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the C-terminal…
3QDO 1.88 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) fused to the Gly-Gly linker…
4P2A 2.7 Å, Structure of mouse VPS26A bound to rat SNX27 PDZ domain
3QGL 3.31 Å, Crystal Structure of PDZ domain of sorting nexin 27 (SNX27) in complex with the ESESKV…

Browse structure collections

About this viewer

MolViewer shows 4Z8J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.