5H78: PKA-DHR14 fusion protein

Crystal structure of the PKA-DHR14 fusion protein. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 3,505
Mol. weight: 44.67 kDa
Released: 28 Jun 2017

Explore 5H78 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H78 contains 18 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-23	15
α-helix	28-57	30
α-helix	61-77	17
α-helix	81-97	17
α-helix	101-117	17
α-helix	121-137	17
α-helix	141-157	17
β-strand	160	1	1
α-helix	161-177	17
α-helix	181-195	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-alpha regulatory subunit,DHR14	A, B	protein	197	Homo sapiens, synthetic construct	P13861 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5H78_1 cAMP-dependent protein kinase type II-alpha regulatory subunit,DHR14 (chains A, B)
GSHMQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLRSERVNERVKQLAEKAKEAT
DKEEVIEIVKELAELAKQSTDSELVNEIVKQLAEVAKEATDKELVIYIVKILAELAKQST
DSELVNEIVKQLAEVAKEATDKELVIYIVKILAELAKQSTDSELVNEIVKQLEEVAKEAT
DKELVEHIEKILEELKK

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Other PDB entries of the same protein (UniProt P13861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IZX 1.3 Å, Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
9NXN 2.1 Å, Crystal structure of CN:RII alpha
4ZP3 2.63 Å, AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of…
5H77 3.2 Å, Crystal structure of the PKA-protein A fusion protein
5XBY 3.25 Å, Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion)
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…
8S8O Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and…

Browse structure collections

About this viewer

MolViewer shows 5H78 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.