8S8O: PDB entry 8S8O

Solution Structure of cAMP-dependent Protein Kinase RII-alpha Subunit Dimerization and Docking Domain Complex with Microtubule Associated Protein 2c (84-111). Determined by solution NMR. Released 25 Sept 2024.

Method: Solution NMR
Organisms: Homo sapiens, Rattus norvegicus
Chains: 3
Atoms: 1,022
Mol. weight: 14.59 kDa
Released: 25 Sept 2024

Explore 8S8O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8S8O contains 6 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	10-11	2
α-helix	14-27	14
α-helix	33-48	16

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	14-28	15
α-helix	33-47	15

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	87-107	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase type II-alpha regulatory subunit	A, B	protein	52	Homo sapiens	P13861 (AlphaFold model)
Isoform 3 of Microtubule-associated protein 2	C	protein	28	Rattus norvegicus	P15146 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8S8O_1 cAMP-dependent protein kinase type II-alpha regulatory subunit (chains A, B)
GAMGMSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPAS

Sequence of entity 2 (C), FASTA

>8S8O_2 Isoform 3 of Microtubule-associated protein 2 (chains C)
RETAEEVSARIVQVVTAEAVAVLKGEQE

Primary citation

Structural basis of binding the unique N-terminal domain of microtubule-associated protein 2c to proteins regulating kinases of signaling pathways. Bartosik, V., Plucarova, J., Lanikova, A. et al. J Biol Chem (2024) 300:107551-107551. DOI 10.1016/j.jbc.2024.107551 · PubMed

Other PDB entries of the same protein (UniProt P13861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IZX 1.3 Å, Molecular Basis of AKAP Specificity for PKA Regulatory Subunits
5H78 2.0 Å, Crystal structure of the PKA-DHR14 fusion protein
9NXN 2.1 Å, Crystal structure of CN:RII alpha
4ZP3 2.63 Å, AKAP18:PKA-RIIalpha structure reveals crucial anchor points for recognition of…
5H77 3.2 Å, Crystal structure of the PKA-protein A fusion protein
5XBY 3.25 Å, Crystal structure of the PKA-Protein A fusion protein (end-to-end fusion)
2KYG Structure of the AML1-ETO Nervy Domain - PKA(RIIa) complex and its contribution to…

Browse structure collections

About this viewer

MolViewer shows 8S8O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.