4ZUD: Human Angiotensin Receptor

Crystal Structure of Human Angiotensin Receptor in Complex with Inverse Agonist Olmesartan at 2.8A resolution. Determined by X-ray diffraction at 2.8 Å resolution. Released 7 Oct 2015.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 2,951
Mol. weight: 47.17 kDa
Ligands: OLM
Released: 7 Oct 2015

Explore 4ZUD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZUD contains 21 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	1003-1018	16
α-helix	1023-1041	19
α-helix	1056-1081	26
α-helix	1084-1090	7
α-helix	1091-1093	3
α-helix	1094-1105	12
β-strand	12-13	2	1
α-helix	14-16	3
α-helix	27-52	26
α-helix	53-57	5
α-helix	62-80	19
α-helix	82-89	8
α-helix	98-131	34
α-helix	142-159	18
α-helix	161-166	6
β-strand	167-172	6	1
β-strand	178-182	5	1
α-helix	191-194	4
α-helix	198-200	3
α-helix	201-205	5
α-helix	206-221	16
α-helix	236-268	33
α-helix	274-292	19
α-helix	294-303	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera protein of Soluble cytochrome b562 and Type-1 angiotensin II receptor	A	protein	410	Escherichia coli, Homo sapiens	P0ABE7 (AlphaFold model), P30556 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4ZUD_1 Chimera protein of Soluble cytochrome b562 and Type-1 angiotensin II receptor (chains A)
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKD
FRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLILNSSDCPKAGRHN
YIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTLPLWA
VYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVA
KVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFL
FPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVL
IQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQ

Ligands and cofactors

ID	Name	Formula	Copies
OLM	Olmesartan	C24 H26 N6 O3	1

Primary citation

Structural Basis for Ligand Recognition and Functional Selectivity at Angiotensin Receptor. Zhang, H., Unal, H., Desnoyer, R. et al. J Biol Chem (2015) 290:29127-29139. DOI 10.1074/jbc.M115.689000 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse more

4ZUD is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 4ZUD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.