5ABS: SH3 domain-containing kinase-binding protein 1

Crystal structure of the C-terminal coiled-coil domain of CIN85 in space group P321. Determined by X-ray diffraction at 1.74 Å resolution. Released 13 Jul 2016.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 554
Mol. weight: 8.15 kDa
Ligands: ZN
Released: 13 Jul 2016

Explore 5ABS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5ABS contains 2 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	600-602	3
α-helix	605-661	57

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 domain-containing kinase-binding protein 1	A	protein	66	HOMO SAPIENS	Q96B97 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5ABS_1 SH3 DOMAIN-CONTAINING KINASE-BINDING PROTEIN 1 (chains A)
GHMEPAASSQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLQMEVN
DIKKAL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

The Adaptor Protein Cin85 Assembles Intracellular Signaling Clusters for B Cell Activation. Kuhn, J., Wong, L.E., Pirkuliyeva, S. et al. Sci Signal (2016) 9:RA66. DOI 10.1126/SCISIGNAL.AAD6275 · PubMed

Other PDB entries of the same protein (UniProt Q96B97 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BZ8 2.0 Å, N-terminal Sh3 domain of CIN85 bound to Cbl-b peptide
2YDL 2.05 Å, Crystal structure of SH3C from CIN85
2K6D CIN85 Sh3-C domain in complex with ubiquitin
2K9G Solution structure of the third SH3 domain of the Cin85 adapter protein
2N64 NMR Structure of the C-terminal Coiled-Coil Domain of CIN85
2O2O Solution structure of domain B from human CIN85 PROTEIN

Browse structure collections

About this viewer

MolViewer shows 5ABS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.