5AFB: Latrophilin3 Lectin and Olfactomedin Domains

Crystal structure of the Latrophilin3 Lectin and Olfactomedin Domains. Determined by X-ray diffraction at 2.16 Å resolution. Released 18 Mar 2015.

Method: X-ray diffraction
Resolution: 2.16 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,930
Mol. weight: 44.51 kDa
Ligands: NAG, CA
Released: 18 Mar 2015

Explore 5AFB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5AFB contains 5 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	99-104	6	1
β-strand	108-112	5	2
β-strand	118-127	10	1
β-strand	128	1	3
β-strand	146	1	3
α-helix	151-159	9
β-strand	164-168	5	2
β-strand	184-192	9	1
α-helix	193-195	3
α-helix	198-201	4
β-strand	209-218	10	4
β-strand	224-227	4	5
β-strand	237-241	5	5
β-strand	249-253	5	5
α-helix	256-261	6
β-strand	266-269	4	5
β-strand	274	1	6
β-strand	280-282	3	7
β-strand	285-289	5	7
β-strand	290	1	6
β-strand	295-300	6	7
β-strand	305-311	7	7
β-strand	332-336	5	8
β-strand	339-345	7	8
β-strand	352-358	7	8
β-strand	365-374	10	8
α-helix	375-377	3
β-strand	380-384	5	9
β-strand	387-392	6	9
β-strand	406-412	7	9
β-strand	417-424	8	9
β-strand	432-438	7	4
β-strand	443-448	6	4
β-strand	451-458	8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Latrophilin-3	A	protein	384	HOMO SAPIENS	Q9HAR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5AFB_1 LATROPHILIN-3 (chains A)
ETGPIPMAVVRRELSCESYPIELRCPGTDVIMIESANYGRTDDKICDSDPAQMENIRCYL
PDAYKIMSQRCNNRTQCAVVAGPDVFPDPCPGTYKYLEVQYECVPYKVEQKVFLCPGLLK
GVYQSEHLFESDHQSGAWCKDPLQASDKIYYMPWTPYRTDTLTEYSSKDDFIAGRPTTTY
KLPHRVDGTGFVVYDGALFFNKERTRNIVKFDLRTRIKSGEAIIANANYHDTSPYRWGGK
SDIDLAVDENGLWVIYATEQNNGKIVISQLNPYTLRIEGTWDTAYDKRSASNAFMICGIL
YVVKSVYEDDDNEATGNKIDYIYNTDQSKDSLVDVPFPNSYQYIAAVDYNPRDNLLYVWN
NYHVVKYSLDFGPLDGTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
CA	Calcium ion	Ca	1

Water and common crystallization additives (NA, GOL) are not listed.

Primary citation

Structural Basis of Latrophilin-Flrt Interaction. Jackson, V.A., Del Toro, D., Carrasquero, M. et al. Structure (2015) 23:774. DOI 10.1016/J.STR.2015.01.013 · PubMed

Other PDB entries of the same protein (UniProt Q9HAR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DJG 2.65 Å, ADGRL3-lectin domain in complex with an activating synthetic antibody fragment
7SF7 2.9 Å, LPHN3 (ADGRL3) 7TM domain bound to tethered agonist in complex with G protein heterotrimer
6VHH 2.97 Å, Human Teneurin-2 and human Latrophilin-3 binary complex
8JMT 3.36 Å, Structure of the adhesion GPCR ADGRL3 in the apo state
5CMN 3.6 Å, FLRT3 LRR domain in complex with LPHN3 Olfactomedin domain
8VTI 3.9 Å, Latrophilin-3 (ADGRL3) HormR and GAIN domains in the context of the holoreceptor

Browse structure collections

About this viewer

MolViewer shows 5AFB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.