8JMT: Adhesion GPCR ADGRL3 in the apo state

Structure of the adhesion GPCR ADGRL3 in the apo state. Determined by electron microscopy at 3.36 Å resolution. Released 6 Sept 2023.

Method: Electron microscopy
Resolution: 3.36 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 1,894
Mol. weight: 85.44 kDa
Released: 6 Sept 2023

Explore 8JMT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8JMT contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	862-881	20
α-helix	895-916	22
α-helix	924-957	34
α-helix	967-971	5
α-helix	972-976	5
α-helix	977-987	11
α-helix	1008-1035	28
α-helix	1149-1167	19
α-helix	1182-1199	18
α-helix	1207-1218	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adhesion G protein-coupled receptor L3,Soluble cytochrome b562	A	protein	758	Homo sapiens, Escherichia coli	Q9HAR2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8JMT_1 Adhesion G protein-coupled receptor L3,Soluble cytochrome b562 (chains A)
DYKDDDDKAVEAREIMWFKTRQGQIAKQPCPAGTIGVSTYLCLAPDGIWDPQGPDLSNCS
SPWVNHITQKLKSGETAANIARELAEQTRNHLNAGDITYSVRAMDQLVGLLDVQLRNLTP
GGKDSAARSLNKLQKRERSCRAYVQAMVETVNNLLQPQALNAWRDLTTSDQLRAATMLLH
TVEESAFVLADNLLKTDIVRENTDNIKLEVARLSTEGNLEDLKFPENMGHGSTIQLSANT
LKQNGRNGEIRVAFVLYNNLGPYLSTENASMKLGTEALSTNHSVIVNSPVITAAINKEFS
NKVYLADPVVFTVKHIKQSEENFNPNCSFWSYSKRTMTGYWSTQGCRLLTTNKTHTTCSC
NHLANFAVLMAHVEVKHSDAVHDLLLDVITWVGILLSLVCLLICIFTFCFFRGLQSDRNT
IHKNLCISLFVAELLFLIGINRTDQPIACAVFAALLHFFFLAAFTWMFLEGVQLYIMLVE
VFESEHSRRKYFYLVGYGMPALIVAVSAAVDYRSYGTDKVCWLRLDTYFIWSFIGPATLI
IMLNVIFLGIALYKMFHHTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQ
KASGSGSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLER
ADNIKSWVIGAIALLCLLGLTWAFGLMYINESTVIMAYLFTIFNSLQGMFIFIFHCVLQK
KVRKEYGKCLRTHAASRLEEELRRRLTEGSHHHHHHHH

Primary citation

A method for structure determination of GPCRs in various states. Guo, Q., He, B., Zhong, Y. et al. Nat Chem Biol (2024) 20:74-82. DOI 10.1038/s41589-023-01389-0 · PubMed

Other PDB entries of the same protein (UniProt Q9HAR2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5AFB 2.16 Å, Crystal structure of the Latrophilin3 Lectin and Olfactomedin Domains
8DJG 2.65 Å, ADGRL3-lectin domain in complex with an activating synthetic antibody fragment
7SF7 2.9 Å, LPHN3 (ADGRL3) 7TM domain bound to tethered agonist in complex with G protein heterotrimer
6VHH 2.97 Å, Human Teneurin-2 and human Latrophilin-3 binary complex
5CMN 3.6 Å, FLRT3 LRR domain in complex with LPHN3 Olfactomedin domain
8VTI 3.9 Å, Latrophilin-3 (ADGRL3) HormR and GAIN domains in the context of the holoreceptor

Browse structure collections

About this viewer

MolViewer shows 8JMT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.