Third WW domain from the E3 ubiquitin-protein ligase NEDD4. Determined by solution NMR. Released 27 Jan 2016.
Explore 5AHT in 3D Show helices and sheets RCSB PDB PDBe
5AHT contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-16 | 5 | 1 |
| β-strand | 22-26 | 5 | 1 |
| β-strand | 31-33 | 3 | 1 |
| α-helix | 37-39 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase NEDD4 | A | protein | 43 | HOMO SAPIENS | P46934 (AlphaFold model) |
>5AHT_1 E3 UBIQUITIN-PROTEIN LIGASE NEDD4 (chains A) GSMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPA
The Nedd4-1 Ww Domain Recognizes the Py Motif Peptide Through Coupled Folding and Binding Equilibria. Panwalkar, V., Neudecker, P., Schmitz, M. et al. Biochemistry (2016) 55:659. DOI 10.1021/ACS.BIOCHEM.5B01028 · PubMed
Other PDB entries of the same protein (UniProt P46934 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5AHT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.