Crystal structure of the cysteine-rich domain of human Frizzled 4 - Crystal Form II. Determined by X-ray diffraction at 2.4 Å resolution. Released 1 Jul 2015.
Explore 5BPQ in 3D Show helices and sheets RCSB PDB PDBe
5BPQ contains 32 α-helices and 25 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 45 | 1 | |
| β-strand | 46-47 | 2 | 1 |
| α-helix | 48 | 1 | |
| β-strand | 60-61 | 2 | 1 |
| α-helix | 72-79 | 8 | |
| α-helix | 80-82 | 3 | |
| α-helix | 83-88 | 6 | |
| α-helix | 94-102 | 9 | |
| β-strand | 105-107 | 3 | 2 |
| β-strand | 110-114 | 5 | 2 |
| β-strand | 116 | 1 | 3 |
| α-helix | 118-134 | 17 | |
| α-helix | 141-143 | 3 | |
| α-helix | 145-147 | 3 | |
| β-strand | 159 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 46-47 | 2 | 4 |
| α-helix | 51-53 | 3 | |
| β-strand | 60-61 | 2 | 4 |
| α-helix | 72-80 | 9 | |
| α-helix | 83-88 | 6 | |
| α-helix | 94-102 | 9 | |
| β-strand | 105 | 1 | 5 |
| β-strand | 110 | 1 | 2 |
| β-strand | 114 | 1 | 5 |
| β-strand | 116 | 1 | 6 |
| α-helix | 118-134 | 17 | |
| α-helix | 141-143 | 3 | |
| α-helix | 145-147 | 3 | |
| β-strand | 159 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 46-47 | 2 | 7 |
| β-strand | 60-61 | 2 | 7 |
| α-helix | 72-79 | 8 | |
| α-helix | 80-82 | 3 | |
| α-helix | 83-88 | 6 | |
| α-helix | 94-102 | 9 | |
| β-strand | 105 | 1 | 8 |
| β-strand | 114 | 1 | 8 |
| β-strand | 116 | 1 | 9 |
| α-helix | 118-135 | 18 | |
| α-helix | 141-143 | 3 | |
| α-helix | 145-147 | 3 | |
| β-strand | 159 | 1 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 46-47 | 2 | 10 |
| α-helix | 51-53 | 3 | |
| β-strand | 60-61 | 2 | 10 |
| α-helix | 72-79 | 8 | |
| α-helix | 80-82 | 3 | |
| α-helix | 83-88 | 6 | |
| α-helix | 94-102 | 9 | |
| β-strand | 105 | 1 | 10 |
| α-helix | 113 | 1 | |
| β-strand | 114 | 1 | 10 |
| β-strand | 116 | 1 | 11 |
| α-helix | 118-134 | 17 | |
| α-helix | 141-143 | 3 | |
| α-helix | 145-147 | 3 | |
| β-strand | 159 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Frizzled-4 | A, B, C, D | protein | 149 | Homo sapiens | Q9ULV1 (AlphaFold model) |
>5BPQ_1 Frizzled-4 (chains A, B, C, D) DTGERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFL CSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMC MEGPGDEEVPLPHKTPIQPGEGTLEVLFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
Water and common crystallization additives (CL) are not listed.
Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan. Chang, T.H., Hsieh, F.L., Zebisch, M. et al. Elife (2015) 4:e06554. DOI 10.7554/eLife.06554 · PubMed
Other PDB entries of the same protein (UniProt Q9ULV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5BPQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.