5UWG: Fz4-CRD

The crystal structure of Fz4-CRD in complex with palmitoleic acid. Determined by X-ray diffraction at 2.56 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 2.56 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,811
Mol. weight: 29.21 kDa
Ligands: NAG, PAM
Released: 14 Jun 2017

Explore 5UWG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UWG contains 13 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	47	1	1
β-strand	60	1	1
β-strand	61	1	2
α-helix	72-80	9
α-helix	83-88	6
α-helix	94-102	9
β-strand	105	1	2
β-strand	114	1	2
β-strand	116	1	3
α-helix	118-133	16
α-helix	141-143	3
α-helix	145-147	3
β-strand	159	1	3

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	46-47	2	4
α-helix	51-53	3
β-strand	60-61	2	4
α-helix	72-81	10
α-helix	83-88	6
α-helix	94-102	9
β-strand	105	1	4
β-strand	114	1	4
β-strand	115-116	2	5
α-helix	118-134	17
α-helix	141-143	3
α-helix	145-147	3
β-strand	158-159	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Frizzled-4	A, B	protein	125	Homo sapiens	Q9ULV1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UWG_1 Frizzled-4 (chains A, B)
EEERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLC
SVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCM
EGPGD

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
PAM	Palmitoleic acid	C16 H30 O2	1

Primary citation

Wnt5a promotes Frizzled-4 signalosome assembly by stabilizing cysteine-rich domain dimerization. DeBruine, Z.J., Ke, J., Harikumar, K.G. et al. Genes Dev (2017) 31:916-926. DOI 10.1101/gad.298331.117 · PubMed

Other PDB entries of the same protein (UniProt Q9ULV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BPB 2.2 Å, Crystal structure of the cysteine-rich domain of human Frizzled 4 - Crystal Form I
5BQE 2.3 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4…
5BPQ 2.4 Å, Crystal structure of the cysteine-rich domain of human Frizzled 4 - Crystal Form II
5CM4 2.4 Å, Crystal structure of human Frizzled 4 Cysteine-Rich Domain (CRD)
6BD4 2.4 Å, Crystal structure of human apo-Frizzled4 receptor
5BQC 3.0 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and…
6NE1 3.01 Å, Designed repeat protein in complex with Fz4
8WMA 3.47 Å, Fzd4/DEP complex (local refined)
8WM9 3.53 Å, Fzd4/DEP complex
5CL1 3.8 Å, Complex structure of Norrin with human Frizzled 4

Browse structure collections

About this viewer

MolViewer shows 5UWG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.