5BQC: Norrin

Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and sucrose octasulfate. Determined by X-ray diffraction at 3.0 Å resolution. Released 1 Jul 2015.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,842
Mol. weight: 31.75 kDa
Ligands: NAG
Released: 1 Jul 2015

Explore 5BQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5BQC contains 7 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	3
β-strand	55	1	4
β-strand	58-66	9	3
β-strand	74-77	4	5
β-strand	89-92	4	5
β-strand	94-109	16	6
β-strand	110	1	4
β-strand	115-130	16	6

Chain B: 7 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	46-47	2	1
β-strand	60-61	2	1
α-helix	65	1
α-helix	72-88	17
α-helix	94-102	9
β-strand	105	1	1
β-strand	114	1	1
β-strand	115-116	2	2
α-helix	118-133	16
α-helix	134-136	3
α-helix	138-140	3
α-helix	141-143	3
β-strand	158-159	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Frizzled-4	B	protein	149	Homo sapiens	Q9ULV1 (AlphaFold model)
Norrin	A	protein	122	Homo sapiens	Q00604 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>5BQC_1 Frizzled-4 (chains B)
DTGERRCDPIRISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFL
CSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMC
MEGPGDEEVPLPHKTPIQPGEGTLEVLFQ

Sequence of entity 2 (A), FASTA

>5BQC_2 Norrin (chains A)
GPGKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSF
STVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNSGTETSQVA
PA

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structure and functional properties of Norrin mimic Wnt for signalling with Frizzled4, Lrp5/6, and proteoglycan. Chang, T.H., Hsieh, F.L., Zebisch, M. et al. Elife (2015) 4:e06554. DOI 10.7554/eLife.06554 · PubMed

Other PDB entries of the same protein (UniProt Q9ULV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BPB 2.2 Å, Crystal structure of the cysteine-rich domain of human Frizzled 4 - Crystal Form I
5BQE 2.3 Å, Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4…
5BPQ 2.4 Å, Crystal structure of the cysteine-rich domain of human Frizzled 4 - Crystal Form II
5CM4 2.4 Å, Crystal structure of human Frizzled 4 Cysteine-Rich Domain (CRD)
6BD4 2.4 Å, Crystal structure of human apo-Frizzled4 receptor
5UWG 2.56 Å, The crystal structure of Fz4-CRD in complex with palmitoleic acid
6NE1 3.01 Å, Designed repeat protein in complex with Fz4
8WMA 3.47 Å, Fzd4/DEP complex (local refined)
8WM9 3.53 Å, Fzd4/DEP complex
5CL1 3.8 Å, Complex structure of Norrin with human Frizzled 4

Browse structure collections

About this viewer

MolViewer shows 5BQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.