5C1M: Active mu-opioid receptor

Crystal structure of active mu-opioid receptor bound to the agonist BU72. Determined by X-ray diffraction at 2.07 Å resolution. Released 5 Aug 2015.

Method: X-ray diffraction
Resolution: 2.07 Å
Organisms: Mus musculus, Lama glama
Chains: 2
Atoms: 3,518
Mol. weight: 49.59 kDa
Ligands: OLC, CLR, VF1, PO4
Released: 5 Aug 2015

Explore 5C1M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C1M contains 16 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	65-92	28
α-helix	93-97	5
α-helix	102-118	17
α-helix	121-129	9
α-helix	136-170	35
α-helix	172-178	7
α-helix	181-205	25
β-strand	206-211	6	1
β-strand	214-219	6	1
α-helix	222	1
α-helix	225-237	13
α-helix	238-242	5
α-helix	243-261	19
α-helix	268-305	38
α-helix	312-332	21
α-helix	333-338	6
α-helix	341-346	6

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7-9	3	2
β-strand	12-14	3	3
β-strand	20-25	6	2
β-strand	32-39	8	3
β-strand	45-51	7	3
β-strand	58-60	3	3
β-strand	68-73	6	2
β-strand	78-83	6	2
α-helix	88-90	3
β-strand	92-99	8	3
β-strand	113-114	2	3
β-strand	118-122	5	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mu-type opioid receptor	A	protein	296	Mus musculus	P42866 (AlphaFold model)
Nanobody 39	B	protein	125	Lama glama

Sequence of entity 1 (A), FASTA

>5C1M_1 Mu-type opioid receptor (chains A)
GSHSLCPQTGSPSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLA
LADALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCH
PVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENL
LKICVFIFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIV
CWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCF

Sequence of entity 2 (B), FASTA

>5C1M_2 Nanobody 39 (chains B)
QVQLVESGGGLVRPGGSLRLSCVDSERTSYPMGWFRRAPGKEREFVASITWSGIDPTYAD
SVADRFTTSRDVANNTLYLQMNSLKHEDTAVYYCAARAPVGQSSSPYDYDYWGQGTQVTV
SSAAA

Ligands and cofactors

ID	Name	Formula	Copies
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	2
CLR	Cholesterol	C27 H46 O	1
VF1	(2R,3S,3aR,5aR,6R,11bR,11cS)-3a-methoxy-3,14-dimethyl-2-phenyl-2,3,3a,6,7,11c-h…	C28 H32 N2 O2	1
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (P6G) are not listed.

Primary citation

Structural insights into mu-opioid receptor activation. Huang, W., Manglik, A., Venkatakrishnan, A.J. et al. Nature (2015) 524:315-321. DOI 10.1038/nature14886 · PubMed

Other PDB entries of the same protein (UniProt P42866 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E0G 2.1 Å, Re-refined model of active mu-opioid receptor (PDB 5c1m) as an adduct with BU72
9O36 2.3 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to fluornitrazene (FNZ)
9ODF 2.4 Å, Structure of the MOR/Gi/Lofentanil Complex, GTP-bound G-Primed
9ODN 2.4 Å, Structure of the MOR/Gi/DAMGO Complex, GTP-Bound, G-Primed
7T2G 2.5 Å, CryoEM structure of mu-opioid receptor - Gi protein complex bound to mitragynine…
9ODE 2.5 Å, Structure of the MOR/Gi/Lofentanil Complex, Nucleotide Free
4DKL 2.8 Å, Crystal structure of the mu-opioid receptor bound to a morphinan antagonist
7UL4 2.8 Å, CryoEM Structure of Inactive MOR Bound to Alvimopan and Mb6
9ODM 2.8 Å, Structure of the MOR/Gi/DAMGO Complex, Nucleotide Free, Baseline
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex

Browse more

5C1M is part of these collections:

GPCRs and cell signaling

About this viewer

MolViewer shows 5C1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.