5C1V: PDB entry 5C1V

Crystal structure analysis of catalytic subunit of human calcineurin. Determined by X-ray diffraction at 3.35 Å resolution. Released 3 Feb 2016.

Method: X-ray diffraction
Resolution: 3.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,077
Mol. weight: 79.98 kDa
Ligands: PO4, ZN, FE
Released: 3 Feb 2016

Explore 5C1V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5C1V contains 35 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	28-29	2	1
α-helix	31-34	4
β-strand	35	1	2
β-strand	41	1	2
α-helix	43-50	8
β-strand	55-56	2	1
α-helix	58-73	16
β-strand	78-81	4	3
α-helix	82	1
α-helix	84	1
β-strand	85-88	4	4
α-helix	95-105	11
β-strand	113-115	3	4
α-helix	126-139	14
β-strand	144-146	3	4
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-183	12
β-strand	188-191	4	3
β-strand	195-198	4	3
α-helix	209-213	5
α-helix	220-222	3
α-helix	226-232	7
β-strand	234-235	2	5
β-strand	248-250	3	5
β-strand	258-260	3	5
α-helix	262-271	10
β-strand	276-279	4	3
α-helix	283-284	2
β-strand	288-290	3	3
α-helix	292	1
β-strand	293	1	6
α-helix	294	1
β-strand	300	1	6
β-strand	302-305	4	3
α-helix	311-313	3
β-strand	319-325	7	4
β-strand	328-334	7	4

Chain B: 17 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	28-29	2	7
α-helix	31-34	4
β-strand	35	1	8
β-strand	41	1	8
α-helix	43-50	8
β-strand	55-56	2	7
α-helix	58-74	17
β-strand	78-81	4	9
α-helix	82	1
α-helix	84	1
β-strand	85-88	4	4
α-helix	95-105	11
β-strand	113-115	3	4
α-helix	126-139	14
β-strand	144-146	3	4
α-helix	147-149	3
α-helix	154-159	6
α-helix	162-169	8
α-helix	172-183	12
β-strand	188-191	4	9
β-strand	195-198	4	9
α-helix	209-214	6
α-helix	220-222	3
α-helix	226-232	7
β-strand	234-235	2	10
β-strand	248-250	3	10
β-strand	258-260	3	10
α-helix	262-271	10
β-strand	276-279	4	9
α-helix	291-292	2
β-strand	293	1	11
α-helix	294	1
β-strand	300	1	11
β-strand	302-304	3	9
β-strand	312-314	3	4
β-strand	321-322	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform	A, B	protein	346	Homo sapiens	Q08209 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5C1V_1 Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform (chains A, B)
SEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVA
LRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVD
RGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDA
FDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGN
EKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFPS
LITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPSWAPNFD

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2
ZN	Zinc ion	Zn	2
FE	FE (III) ion	Fe	2

Primary citation

Calcineurin Undergoes a Conformational Switch Evoked via Peptidyl-Prolyl Isomerization. Guasch, A., Aranguren-Ibanez, A., Perez-Luque, R. et al. PLoS One (2015) 10:e0134569-e0134569. DOI 10.1371/journal.pone.0134569 · PubMed

Other PDB entries of the same protein (UniProt Q08209 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2W73 1.45 Å, High-resolution structure of the complex between calmodulin and a peptide from…
4F0Z 1.7 Å, Crystal Structure of Calcineurin in Complex with the Calcineurin-Inhibiting Domain of…
6UUQ 1.85 Å, Structure of Calcineurin bound to RCAN1
2R28 1.86 Å, The complex Structure of Calmodulin Bound to a Calcineurin Peptide
6NUC 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
6NUF 1.9 Å, Structure of Calcineurin in complex with NHE1 peptide
4Q5U 1.95 Å, Structure of calmodulin bound to its recognition site from calcineurin
3LL8 2.0 Å, Crystal Structure of Calcineurin in Complex with AKAP79 Peptide
9NXE 2.09 Å, Crystal Structure of Calcineurin Clinical Variant E282K
1AUI 2.1 Å, Human calcineurin heterodimer
9NXN 2.1 Å, Crystal structure of CN:RII alpha
2P6B 2.3 Å, Crystal Structure of Human Calcineurin in Complex with PVIVIT Peptide

Browse structure collections

About this viewer

MolViewer shows 5C1V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.