5CD8: NTD of Drosophila Oskar protein
Crystal structure of the NTD of Drosophila Oskar protein. Determined by X-ray diffraction at 3.0 Å resolution. Released 2 Sept 2015.
- Method
- X-ray diffraction
- Resolution
- 3.0 Å
- Organism
- Drosophila melanogaster
- Chains
- 6
- Atoms
- 3,466
- Mol. weight
- 62.58 kDa
- Released
- 2 Sept 2015
Explore 5CD8 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5CD8 contains 23 α-helices and 18 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 156-167 | 12 | |
| β-strand | 172 | 1 | 1 |
| α-helix | 174-185 | 12 | |
| α-helix | 195-201 | 7 | |
| β-strand | 205-209 | 5 | 1 |
| β-strand | 215-219 | 5 | 1 |
| α-helix | 220-222 | 3 | |
Chain B: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 149-151 | 3 | |
| α-helix | 156-167 | 12 | |
| β-strand | 172 | 1 | 1 |
| α-helix | 174-185 | 12 | |
| α-helix | 195-199 | 5 | |
| β-strand | 206-209 | 4 | 1 |
| β-strand | 215-218 | 4 | 1 |
Chain C: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 156-167 | 12 | |
| β-strand | 172 | 1 | 2 |
| α-helix | 174-185 | 12 | |
| α-helix | 188-189 | 2 | |
| α-helix | 195-200 | 6 | |
| β-strand | 205-209 | 5 | 2 |
| β-strand | 215-219 | 5 | 2 |
Chain D: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 150-152 | 3 | |
| α-helix | 156-166 | 11 | |
| β-strand | 172 | 1 | 2 |
| α-helix | 174-185 | 12 | |
| α-helix | 188-189 | 2 | |
| α-helix | 195-199 | 5 | |
| β-strand | 206-209 | 4 | 2 |
| β-strand | 215-218 | 4 | 2 |
Chain E: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 156-167 | 12 | |
| β-strand | 172 | 1 | 3 |
| α-helix | 174-184 | 11 | |
| α-helix | 195-201 | 7 | |
| β-strand | 205-209 | 5 | 3 |
| β-strand | 215-219 | 5 | 3 |
Chain F: 3 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 156-167 | 12 | |
| β-strand | 172 | 1 | 3 |
| α-helix | 174-185 | 12 | |
| α-helix | 195-199 | 5 | |
| β-strand | 205-209 | 5 | 3 |
| β-strand | 215-219 | 5 | 3 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Maternal effect protein oskar | A, B, C, D, E, F | protein | 93 | Drosophila melanogaster | P25158 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F), FASTA
>5CD8_1 Maternal effect protein oskar (chains A, B, C, D, E, F)
GSREEYPDIDSEVRAILLSHAQNGITISSIKSEYRKLTGNPFPLHDNVTDFLLTIPNVTA
ECSESGKRIFNLKASLKNGHLLDMVLNQKERTS
Primary citation
Structure of Drosophila Oskar reveals a novel RNA binding protein. Yang, N., Yu, Z., Hu, M. et al. Proc Natl Acad Sci U S A (2015) 112:11541-11546. DOI 10.1073/pnas.1515568112 · PubMed
Other PDB entries of the same protein (UniProt P25158 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5NT7 1.4 Å, Structure of the LOTUS domain of Oskar in complex with the C-terminal RecA-like domain…
- 5A4A 1.7 Å, Crystal structure of the OSK domain of Drosophila Oskar
- 5A49 2.1 Å, Crystal structure of the LOTUS domain (aa 139-222) of Drosophila Oskar in C222
- 5CD9 2.1 Å, Crystal structure of the CTD of Drosophila Oskar protein
- 5A48 2.35 Å, Crystal structure of the LOTUS domain (aa 139-240) of Drosophila Oskar in P65
- 5CD7 2.5 Å, Crystal structure of the NTD L199M of Drosophila Oskar protein
Browse structure collections
About this viewer
MolViewer shows 5CD8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.