5CD9: CTD of Drosophila Oskar protein

Name: PDB 5CD9: Crystal structure of the CTD of Drosophila Oskar protein
Published: 2015-09-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: rna binding protein

Crystal structure of the CTD of Drosophila Oskar protein. Determined by X-ray diffraction at 2.1 Å resolution. Released 2 Sept 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 2,001
Mol. weight: 25.98 kDa
Released: 2 Sept 2015

Explore 5CD9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CD9 contains 11 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	407-410	4
β-strand	419-420	2	1
β-strand	423-424	2	1
β-strand	425-427	3	2
α-helix	429-438	10
β-strand	451-452	2	2
β-strand	454-456	3	2
α-helix	461-469	9
β-strand	478-482	5	2
α-helix	485-489	5
α-helix	494-510	17
β-strand	514-518	5	2
α-helix	520-522	3
α-helix	524-526	3
α-helix	530-546	17
β-strand	552-553	2	2
α-helix	557-559	3
β-strand	560	1	3
β-strand	566	1	3
α-helix	568-570	3
β-strand	571	1	4
β-strand	576	1	5
β-strand	585	1	5
β-strand	588	1	4
α-helix	590-602	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maternal effect protein oskar	A	protein	216	Drosophila melanogaster	P25158 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5CD9_1 Maternal effect protein oskar (chains A)
GSMTPTPTILTSGTYNDSLLTINSDYDAYLLDFPLMGDDFMLYLARMELKCRFRRHERVL
QSGLCVSGLTINGARNRLKRVQLPEGTQIIVNIGSVDIMRGKPLVQIEHDFRLLIKEMHN
MRLVPILTNLAPLGNYCHDKVLCDKIYRFNKFIRSECCHLKVIDIHSCLINERGVVRFDC
FQASPRQVTGSKEPYLFWNKIGRQRVLQVIETSLEY

Primary citation

Structure of Drosophila Oskar reveals a novel RNA binding protein. Yang, N., Yu, Z., Hu, M. et al. Proc Natl Acad Sci U S A (2015) 112:11541-11546. DOI 10.1073/pnas.1515568112 · PubMed

Other PDB entries of the same protein (UniProt P25158 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NT7 1.4 Å, Structure of the LOTUS domain of Oskar in complex with the C-terminal RecA-like domain…
5A4A 1.7 Å, Crystal structure of the OSK domain of Drosophila Oskar
5A49 2.1 Å, Crystal structure of the LOTUS domain (aa 139-222) of Drosophila Oskar in C222
5A48 2.35 Å, Crystal structure of the LOTUS domain (aa 139-240) of Drosophila Oskar in P65
5CD7 2.5 Å, Crystal structure of the NTD L199M of Drosophila Oskar protein
5CD8 3.0 Å, Crystal structure of the NTD of Drosophila Oskar protein

Browse structure collections

About this viewer

MolViewer shows 5CD9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.