Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile. Determined by X-ray diffraction at 3.1 Å resolution. Released 12 Aug 2015.
Explore 5CGC in 3D Show helices and sheets RCSB PDB PDBe
5CGC contains 20 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 569-575 | 7 | |
| α-helix | 579-603 | 25 | |
| α-helix | 608-611 | 4 | |
| α-helix | 615-630 | 16 | |
| α-helix | 631-633 | 3 | |
| β-strand | 636 | 1 | 1 |
| α-helix | 642-1010 | 46 | |
| β-strand | 1016 | 1 | 2 |
| β-strand | 1018-1019 | 2 | 3 |
| β-strand | 1025-1027 | 3 | 3 |
| β-strand | 1031-1032 | 2 | 3 |
| α-helix | 1039-1050 | 12 | |
| β-strand | 1057 | 1 | 2 |
| α-helix | 1060-1079 | 20 | |
| α-helix | 1085-1090 | 6 | |
| α-helix | 1093-1106 | 14 | |
| α-helix | 1108-1111 | 4 | |
| α-helix | 1115-1122 | 8 | |
| α-helix | 1126-1133 | 8 | |
| α-helix | 1137-1141 | 5 | |
| α-helix | 1143-1155 | 13 | |
| α-helix | 692-714 | 23 | |
| β-strand | 719 | 1 | 4 |
| β-strand | 730 | 1 | 1 |
| β-strand | 733 | 1 | 4 |
| α-helix | 738-760 | 23 | |
| α-helix | 766-792 | 27 | |
| α-helix | 798-817 | 20 | |
| α-helix | 819-827 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 | A | protein | 444 | Homo sapiens, Enterobacteria phage T4 | P00720, P41594 (AlphaFold model) |
>5CGC_1 Metabotropic glutamate receptor 5,Endolysin,Metabotropic glutamate receptor 5 (chains A) AASPVQYLRWGDPAPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGI CLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTYRAARILAMSKKNIFEMLR IDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFN QDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDE AAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYKICTKKPRFMSACAQLVIAFILICIQL GIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVAPLGYNGLLILACTFYAFKTRNVP ANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYII LAKPERNVRSAAAAHHHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| OLA | Oleic acid | C18 H34 O2 | 4 |
| 51D | 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile | C14 H7 Cl F N5 | 1 |
Water and common crystallization additives (MES) are not listed.
Fragment and Structure-Based Drug Discovery for a Class C GPCR: Discovery of the mGlu5 Negative Allosteric Modulator HTL14242 (3-Chloro-5-[6-(5-fluoropyridin-2-yl)pyrimidin-4-yl]benzonitrile). Christopher, J.A., Aves, S.J., Bennett, K.A. et al. J Med Chem (2015) 58:6653-6664. DOI 10.1021/acs.jmedchem.5b00892 · PubMed
Other PDB entries of the same protein (UniProt P00720), best resolution first:
MolViewer shows 5CGC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.