5CHW: ISG15 in space group P212121

Structure of ISG15 in space group P212121. Determined by X-ray diffraction at 2.1 Å resolution. Released 28 Sept 2016.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 10
Atoms: 12,085
Mol. weight: 175.8 kDa
Released: 28 Sept 2016

Explore 5CHW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CHW contains 86 α-helices and 142 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
β-strand	14-19	6	1
β-strand	24	1	2
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	1
β-strand	50-51	2	1
α-helix	52-53	2
β-strand	57	1	2
α-helix	59-61	3
β-strand	68-73	6	1
β-strand	80-85	6	3
β-strand	91-96	6	3
β-strand	101	1	4
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	3
β-strand	127-128	2	3
α-helix	129-130	2
β-strand	134	1	4
α-helix	135-138	4
β-strand	145-150	6	3
α-helix	152-154	3

Chain B: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	5
β-strand	14-19	6	5
β-strand	24	1	6
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	5
β-strand	50-51	2	5
α-helix	52-53	2
β-strand	57	1	6
α-helix	59-61	3
β-strand	68-73	6	5
β-strand	80-85	6	7
β-strand	91-96	6	7
β-strand	101	1	8
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	7
β-strand	127-128	2	7
α-helix	129-130	2
β-strand	134	1	8
α-helix	135-138	4
β-strand	145-150	6	7

Chain C: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	9
β-strand	14-19	6	9
β-strand	24	1	10
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	9
β-strand	50-51	2	9
α-helix	52-53	2
β-strand	57	1	10
α-helix	59-61	3
β-strand	68-73	6	9
α-helix	77-79	3
β-strand	80-85	6	11
β-strand	91-96	6	11
β-strand	101	1	12
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	11
β-strand	127-128	2	11
α-helix	129-130	2
β-strand	134	1	12
α-helix	135-138	4
β-strand	145-150	6	11

Chain D: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	13
β-strand	14-19	6	13
β-strand	24	1	14
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	13
β-strand	50-51	2	13
α-helix	52-53	2
β-strand	57	1	14
α-helix	59-61	3
β-strand	68-73	6	13
α-helix	77-79	3
β-strand	80-85	6	15
β-strand	91-96	6	15
β-strand	101	1	16
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	15
β-strand	127-128	2	15
α-helix	129-130	2
β-strand	134	1	16
α-helix	135-138	4
β-strand	145-150	6	15

Chain E: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	17
β-strand	14-19	6	17
β-strand	24	1	18
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	17
β-strand	50-51	2	17
α-helix	52-53	2
β-strand	57	1	18
β-strand	68-73	6	17
β-strand	80-85	6	19
β-strand	91-96	6	19
β-strand	101	1	20
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	19
β-strand	127-128	2	19
α-helix	129-130	2
β-strand	134	1	20
α-helix	135-138	4
β-strand	145-150	6	19

Chain F: 11 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	3	1
β-strand	4	1	21
α-helix	5-6	2
β-strand	7-8	2	22
β-strand	14-15	2	22
β-strand	18	1	21
β-strand	24	1	23
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	22
β-strand	50-51	2	22
α-helix	52-53	2
α-helix	56	1
β-strand	57	1	23
β-strand	69-73	5	22
α-helix	77-79	3
β-strand	80-85	6	24
β-strand	91-96	6	24
β-strand	101	1	25
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	24
β-strand	127-128	2	24
α-helix	129-130	2
β-strand	134	1	25
α-helix	135-138	4
β-strand	145-150	6	24

Chain G: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	26
β-strand	14-19	6	26
β-strand	24	1	27
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	26
β-strand	50-51	2	26
α-helix	52-53	2
β-strand	57	1	27
β-strand	68-73	6	26
β-strand	80-86	7	28
β-strand	91-96	6	28
β-strand	101	1	29
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	28
β-strand	127-128	2	28
α-helix	129-130	2
β-strand	134	1	29
α-helix	135-138	4
β-strand	145-150	6	28
α-helix	152-154	3

Chain H: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	30
β-strand	14-19	6	30
β-strand	24	1	31
α-helix	25-36	12
α-helix	40-42	3
β-strand	43-47	5	30
β-strand	50-51	2	30
α-helix	52-53	2
β-strand	57	1	31
α-helix	59-61	3
β-strand	68-73	6	30
β-strand	79-85	7	32
β-strand	91-97	7	32
β-strand	101	1	33
α-helix	102-113	12
α-helix	117-119	3
β-strand	120-124	5	32
β-strand	127-128	2	32
α-helix	129-130	2
β-strand	134	1	33
α-helix	135-138	4
β-strand	145-150	6	32

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like protein ISG15	A, B, C, D, E, F, G, H, I, J	protein	155	Mus musculus	Q64339 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J), FASTA

>5CHW_1 Ubiquitin-like protein ISG15 (chains A, B, C, D, E, F, G, H, I, J)
MAWDLKVKMLGGNDFLVSVTNSMTVSELKKQIAQKIGVPAFQQRLAHQTAVLQDGLTLSS
LGLGPSSTVMLVVQNSSEPLSILVRNERGHSNIYEVFLTQTVDTLKKKVSQREQVHEDQF
WLSFEGRPMEDKELLGEYGLKPQCTVIKHLRLRGG

Primary citation

Structure of ISG15 in space group P212121. Fritz, G., Basters, A. To be published.

Other PDB entries of the same protein (UniProt Q64339 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CHF 2.3 Å, Crystal structure of murine ISG15 in space group P21212
5TL7 2.44 Å, Crystal structure of SARS-CoV papain-like protease in complex with C-terminal domain…
5JZE 2.47 Å, Erve virus viral OTU domain protease in complex with mouse ISG15
6J62 2.49 Å, Crystal structure of mISG15/NS1B complex
5CHV 3.0 Å, Crystal structure of USP18-ISG15 complex
6YVA 3.18 Å, PLpro-C111S with mISG15
5TLA 3.24 Å, Crystal structure of mouse ISG15

Browse structure collections

About this viewer

MolViewer shows 5CHW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.