mGlu2 with Glutamate. Determined by X-ray diffraction at 2.69 Å resolution. Released 9 Sept 2015.
Explore 5CNI in 3D Show helices and sheets RCSB PDB PDBe
5CNI contains 40 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-28 | 3 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 41-43 | 3 | 2 |
| β-strand | 50-53 | 4 | 2 |
| α-helix | 55-60 | 6 | |
| α-helix | 61-72 | 12 | |
| β-strand | 84-90 | 7 | 1 |
| α-helix | 95-106 | 12 | |
| β-strand | 138-140 | 3 | 1 |
| α-helix | 145-155 | 11 | |
| α-helix | 156-158 | 3 | |
| β-strand | 162-164 | 3 | 1 |
| α-helix | 170-173 | 4 | |
| β-strand | 181-183 | 3 | 1 |
| α-helix | 189-201 | 13 | |
| β-strand | 206-212 | 7 | 3 |
| α-helix | 217-229 | 13 | |
| β-strand | 234-241 | 8 | 3 |
| α-helix | 247-258 | 12 | |
| β-strand | 265-269 | 5 | 3 |
| α-helix | 272-284 | 13 | |
| β-strand | 290-293 | 4 | 3 |
| α-helix | 301-304 | 4 | |
| α-helix | 308-311 | 4 | |
| β-strand | 315-319 | 5 | 3 |
| α-helix | 325-332 | 8 | |
| α-helix | 345-353 | 9 | |
| α-helix | 378-399 | 22 | |
| α-helix | 408-410 | 3 | |
| α-helix | 415-417 | 3 | |
| α-helix | 418-422 | 5 | |
| α-helix | 423-425 | 3 | |
| β-strand | 428-429 | 2 | 4 |
| α-helix | 430 | 1 | |
| β-strand | 440-441 | 2 | 4 |
| β-strand | 452-460 | 9 | 3 |
| β-strand | 466-475 | 10 | 3 |
| β-strand | 478-480 | 3 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-28 | 3 | 5 |
| β-strand | 32-38 | 7 | 5 |
| β-strand | 41-43 | 3 | 6 |
| β-strand | 50-53 | 4 | 6 |
| α-helix | 55-60 | 6 | |
| α-helix | 61-72 | 12 | |
| β-strand | 84-90 | 7 | 5 |
| α-helix | 95-106 | 12 | |
| β-strand | 136-140 | 5 | 5 |
| α-helix | 145-155 | 11 | |
| α-helix | 156-158 | 3 | |
| β-strand | 162-164 | 3 | 5 |
| α-helix | 170-173 | 4 | |
| β-strand | 181-183 | 3 | 5 |
| α-helix | 188-201 | 14 | |
| β-strand | 206-212 | 7 | 7 |
| α-helix | 217-229 | 13 | |
| β-strand | 234-241 | 8 | 7 |
| α-helix | 247-258 | 12 | |
| β-strand | 265-269 | 5 | 7 |
| α-helix | 272-284 | 13 | |
| β-strand | 290-293 | 4 | 7 |
| α-helix | 301-304 | 4 | |
| α-helix | 308-311 | 4 | |
| β-strand | 315-319 | 5 | 7 |
| α-helix | 325-332 | 8 | |
| α-helix | 345-352 | 8 | |
| α-helix | 378-399 | 22 | |
| α-helix | 408-410 | 3 | |
| α-helix | 415-417 | 3 | |
| α-helix | 418-422 | 5 | |
| α-helix | 423-425 | 3 | |
| β-strand | 428-429 | 2 | 8 |
| α-helix | 430-431 | 2 | |
| β-strand | 440-441 | 2 | 8 |
| β-strand | 452-460 | 9 | 7 |
| β-strand | 466-475 | 10 | 7 |
| β-strand | 478 | 1 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metabotropic glutamate receptor 2 | A, B | protein | 503 | Homo sapiens | Q14416 (AlphaFold model) |
>5CNI_1 Metabotropic glutamate receptor 2 (chains A, B) MALGSLLALLALLLLWGAVAEGPAKKVLTLEGDLVLGGLFPVHQKGGPAEDCGPVNEHRG IQRLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKDTHALEQALDFVRASLSRGADGSR HICPDGSYATHGDAPTAITGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRY DYFARTVPPDFFQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFELEARARNISVATS EKVGRAMSRAAFEGVVRALLQKPSARVAVLFTRSEDARELLAASQRLNASFTWVASDGWG ALEEVVAGSEGAAEGAITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFR QRDCAAHSLRAVPFEQESKIMFVVNAVYAMAHALHNMHRALCPNTTRLCDAMRPVNGRRL YKDFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGL TLDTSLIPWASPSAGEGHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
| GLU | Glutamic acid | C5 H9 N O4 | 2 |
Water and common crystallization additives (NA, CL) are not listed.
Synthesis and Pharmacological Characterization of C4-(Thiotriazolyl)-substituted-2-aminobicyclo[3.1.0]hexane-2,6-dicarboxylates. Identification of (1R,2S,4R,5R,6R)-2-Amino-4-(1H-1,2,4-triazol-3-ylsulfanyl)bicyclo[3.1.0]hexane-2,6-dicarboxylic Acid (LY2812223), a Highly Potent, Functionally…. Monn, J.A., Prieto, L., Taboada, L. et al. J Med Chem (2015) 58:7526-7548. DOI 10.1021/acs.jmedchem.5b01124 · PubMed
Other PDB entries of the same protein (UniProt Q14416 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5CNI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.