Metabotropic Glutamate Receptor. Determined by X-ray diffraction at 2.8 Å resolution. Released 28 Dec 2016.
Explore 5KZN in 3D Show helices and sheets RCSB PDB PDBe
5KZN contains 29 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 26-28 | 3 | 1 |
| β-strand | 32-38 | 7 | 1 |
| β-strand | 41-43 | 3 | 2 |
| β-strand | 50-53 | 4 | 2 |
| α-helix | 55-60 | 6 | |
| α-helix | 61-74 | 14 | |
| β-strand | 84-90 | 7 | 1 |
| α-helix | 95-108 | 14 | |
| α-helix | 134-136 | 3 | |
| β-strand | 138-141 | 4 | 1 |
| α-helix | 145-155 | 11 | |
| α-helix | 156-158 | 3 | |
| β-strand | 162-164 | 3 | 1 |
| α-helix | 170-173 | 4 | |
| β-strand | 181-183 | 3 | 1 |
| α-helix | 186-187 | 2 | |
| α-helix | 188-191 | 4 | |
| α-helix | 192-201 | 10 | |
| β-strand | 206-212 | 7 | 3 |
| α-helix | 215-230 | 16 | |
| β-strand | 234-241 | 8 | 3 |
| α-helix | 247-257 | 11 | |
| β-strand | 265-269 | 5 | 3 |
| α-helix | 272-284 | 13 | |
| β-strand | 290-293 | 4 | 3 |
| α-helix | 302-304 | 3 | |
| α-helix | 308-311 | 4 | |
| β-strand | 315-319 | 5 | 3 |
| α-helix | 325-332 | 8 | |
| α-helix | 345-352 | 8 | |
| α-helix | 371-372 | 2 | |
| α-helix | 378-399 | 22 | |
| α-helix | 408-410 | 3 | |
| α-helix | 415-417 | 3 | |
| α-helix | 418-423 | 6 | |
| β-strand | 428-429 | 2 | 4 |
| α-helix | 430 | 1 | |
| β-strand | 440-441 | 2 | 4 |
| β-strand | 443 | 1 | 5 |
| α-helix | 448 | 1 | |
| β-strand | 449 | 1 | 5 |
| α-helix | 450 | 1 | |
| β-strand | 453-460 | 8 | 3 |
| β-strand | 466-475 | 10 | 3 |
| β-strand | 477-480 | 4 | 3 |
| α-helix | 482-484 | 3 | |
| α-helix | 494-497 | 4 | |
| α-helix | 502-504 | 3 | |
| β-strand | 508-511 | 4 | 6 |
| β-strand | 521-524 | 4 | 6 |
| α-helix | 525-526 | 2 | |
| β-strand | 529-533 | 5 | 7 |
| β-strand | 536-539 | 4 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Metabotropic glutamate receptor 2 | A | protein | 570 | Homo sapiens | Q14416 (AlphaFold model) |
>5KZN_1 Metabotropic glutamate receptor 2 (chains A) MGSLLALLALLLLWGAVAEGPAKKVLTLEGDLVLGGLFPVHQKGGPAEDCGPVNEHRGIQ RLEAMLFALDRINRDPHLLPGVRLGAHILDSCSKDTHALEQALDFVRASLSRGADGSRHI CPDGSYATHGDAPTAITGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDY FARTVPPDFFQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFELEARARNICVATSEK VGRAMSRAAFEGVVRALLQKPSARVAVLFTRSEDARELLAASQRLNASFTWVASDGWGAL ESVVAGSEGAAEGAITIELASYPISDFASYFQSLDPWNNSRNPWFREFWEQRFRCSFRQR DCAAHSLRAVPFEQESKIMFVVNAVYAMAHALHNMHRALCPNTTRLCDAMRPVNGRRLYK DFVLNVKFDAPFRPADTHNEVRFDRFGDGIGRYNIFTYLRAGSGRYRYQKVGYWAEGLTL DTSLIPWASPSAGPLPASRCSEPCLQNEVKSVQPGEVCCWLCIPCQPYEYRLDEFTCADC GLGYWPNASLTGCFELPQEYIREGHHHHHH
Discovery of (1S,2R,3S,4S,5R,6R)-2-Amino-3-[(3,4-difluorophenyl)sulfanylmethyl]-4-hydroxy-bicyclo[3.1.0]hexane-2,6-dicarboxylic Acid Hydrochloride (LY3020371HCl): A Potent, Metabotropic Glutamate 2/3 Receptor Antagonist with Antidepressant-Like Activity. Chappell, M.D., Li, R., Smith, S.C. et al. J Med Chem (2016) 59:10974-10993. PubMed
Other PDB entries of the same protein (UniProt Q14416 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5KZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.