5COC: Immunoglobulin G-binding protein A,Calmodulin

Fusion protein of human calmodulin and B4 domain of protein A from staphylococcal aureus. Determined by X-ray diffraction at 2.67 Å resolution. Released 30 Mar 2016.

Method: X-ray diffraction
Resolution: 2.67 Å
Organisms: Staphylococcus aureus, Homo sapiens
Chains: 1
Atoms: 978
Mol. weight: 14.63 kDa
Ligands: CA
Released: 30 Mar 2016

Explore 5COC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5COC contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	219-229	11
α-helix	235-246	12
α-helix	249-251	3
α-helix	252-263	12
α-helix	1006-1020	15
β-strand	1028	1	1
α-helix	1030-1038	9
α-helix	1046-1054	9
β-strand	1064	1	1
α-helix	1066-1075	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein A,Calmodulin	A	protein	130	Staphylococcus aureus, Homo sapiens	P0DP24 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5COC_1 Immunoglobulin G-binding protein A,Calmodulin (chains A)
VDNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKCLNDAQAAAEE
CIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPE
FLTMMARKMK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker. Jeong, W.H., Lee, H., Song, D.H. et al. Nat Commun (2016) 7:11031-11031. DOI 10.1038/ncomms11031 · PubMed

Other PDB entries of the same protein (UniProt P0DP24 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6XXF 1.7 Å, 1.7 Angstrom crystal structure of Ca/CaM:RyR2 peptide complex
6SZ5 2.23 Å, Human calmodulin bound to a peptide of human NADPH oxidase 5
3O77 2.35 Å, The structure of Ca2+ Sensor (Case-16)
8KA0 2.35 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
7MIR 2.5 Å, Cryo-EM structure of SidJ-SdeA-CaM reaction intermediate complex
6PLM 2.59 Å, Legionella pneumophila SidJ/ Calmodulin 2 complex
3O78 2.6 Å, The structure of Ca2+ Sensor (Case-12)
6MUD 2.69 Å, Voltage-gated sodium channel NaV1.5 C-terminal domain in complex with Ca2+/Calmodulin
7MIS 2.8 Å, Cryo-EM structure of SidJ-SdeC-CaM reaction intermediate complex
8KA1 2.82 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
8K9Z 2.9 Å, Crystal structure of Vibrio vulnificus RID-dependent transforming NADase domain…
7PPO 2.91 Å, Structure of SidJ/CaM bound to SdeA in pre-glutamylation state

Browse structure collections

About this viewer

MolViewer shows 5COC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.