5CTD: Collagen alpha-1 chain,Collagen alpha-1 chain

Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest fragment a2a1a1 of type I collagen. Determined by X-ray diffraction at 1.6 Å resolution. Released 3 Aug 2016.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,632
Mol. weight: 21.06 kDa
Released: 3 Aug 2016

Explore 5CTD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CTD contains 11 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-32	26
α-helix	34-40	7
α-helix	41-53	13
α-helix	56-63	8

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	13-40	28
α-helix	42-68	27

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	4-5	2
α-helix	7-29	23
α-helix	31-40	10
α-helix	41-62	22
α-helix	69-71	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain	A	protein	71	Homo sapiens	P02452 (AlphaFold model), P20849 (AlphaFold model)
Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain	B	protein	71	Homo sapiens	P08123 (AlphaFold model), Q14055 (AlphaFold model)
Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain	C	protein	72	Homo sapiens	P02452 (AlphaFold model), Q14050

Sequence of entity 1 (A), FASTA

>5CTD_1 Collagen alpha-1(I) chain,Collagen alpha-1(IX) chain (chains A)
GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGRAPTDQHIKQVCMRVIQEHFAEMA
ASLKRPDSGAT

Sequence of entity 2 (B), FASTA

>5CTD_2 Collagen alpha-2(I) chain,Collagen alpha-2(IX) chain (chains B)
GSGPPGPPGPPGPPGARGEPGNIGFPGPPGPPGPPGRDATDQHIVDVALKMLQEQLAEVA
VSAKREALGAV

Sequence of entity 3 (C), FASTA

>5CTD_3 Collagen alpha-1(I) chain,Collagen alpha-3(IX) chain (chains C)
GSGPPGPPGPPGPPGARGQAGVMGFPGPPGPPGPPGKEASEQRIRELCGGMISEQIAQLA
AHLRKPLAPGSI

Primary citation

Structural insight for chain selection and stagger control in collagen. Boudko, S.P., Bachinger, H.P. Sci Rep (2016) 6:37831-37831. DOI 10.1038/srep37831 · PubMed

Other PDB entries of the same protein (UniProt P02452 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8YV3 1.68 Å, The heterotrimer structure of peptides derived from human collagen type I
1Q7D 1.8 Å, Structure of the integrin alpha2beta1 binding collagen peptide
5CTI 1.9 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
5CVA 2.1 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
3EJH 2.1 Å, Crystal Structure of the Fibronectin 8-9FnI Domain Pair in Complex with a Type-I…
5K31 2.2 Å, Crystal structure of Human fibrillar procollagen type I C-propeptide Homo-trimer
5CVB 2.25 Å, Crystal structure of the type IX collagen NC2 hetero-trimerization domain with a guest…
5OU8 2.5 Å, Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)5
5OU9 2.5 Å, Crystal structure of Glycoprotein VI in complex with collagen-peptide (GPO)3
3GXE 2.6 Å, Complex of a Low Affinity Collagen Site with the Fibronectin 8-9FnI Domain Pair
7E7B 2.6 Å, Cryo-EM structure of the SARS-CoV-2 furin site mutant S-Trimer from a subunit vaccine…
7E7D 3.2 Å, Cryo-EM structure of the SARS-CoV-2 wild-type S-Trimer from a subunit vaccine candidate

Browse structure collections

About this viewer

MolViewer shows 5CTD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.