5D7E: Taf14 YEATS domain

Crystal structure of Taf14 YEATS domain in complex with H3K9ac. Determined by X-ray diffraction at 1.9 Å resolution. Released 23 Sept 2015.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Saccharomyces cerevisiae (strain ATCC 204508 / S288c), Saccharomyces cerevisiae
Chains: 2
Atoms: 1,311
Mol. weight: 17.44 kDa
Released: 23 Sept 2015

Explore 5D7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5D7E contains 6 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	-1-2	4
β-strand	4-17	14	1
α-helix	22-23	2
β-strand	24	1	2
β-strand	27	1	2
α-helix	28-29	2
β-strand	30-39	10	1
β-strand	45-47	3	1
β-strand	51-57	7	3
β-strand	66-69	4	3
β-strand	76-80	5	1
β-strand	83	1	4
β-strand	84-92	9	3
α-helix	93-95	3
β-strand	97-105	9	3
β-strand	111-121	11	1
α-helix	125-131	7
α-helix	132-134	3

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	7	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 14	A	protein	140	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P35189 (AlphaFold model)
H3K9ac	C	protein	8	Saccharomyces cerevisiae	P61830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5D7E_1 Transcription initiation factor TFIID subunit 14 (chains A)
LGSMVATVKRTIRIKTQQHILPEVPPVENFPVRQWSIEIVLLDDEGKEIPATIFDKVIYH
LHPTFANPNRTFTDPPFRIEEQGWGGFPLDISVFLLEKAGERKIPHDLNFLQESYEVEHV
IQIPLNKPLLTEELAKSGST

Sequence of entity 2 (C), FASTA

>5D7E_2 H3K9ac (chains C)
AQTARKST

Primary citation

Association of Taf14 with acetylated histone H3 directs gene transcription and the DNA damage response. Shanle, E.K., Andrews, F.H., Meriesh, H. et al. Genes Dev (2015) 29:1795-1800. DOI 10.1101/gad.269977.115 · PubMed

Other PDB entries of the same protein (UniProt P35189 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UHE 1.66 Å, Taf14 ET domain in complex with C-terminal tail of Taf2
3QRL 1.7 Å, Crystal Structure of the Taf14 YEATS domain
6MIQ 1.75 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9bu
6MIO 1.85 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9pr
6MIN 1.9 Å, Crystal structure of Taf14 YEATS domain G82A mutant in complex with histone H3K9cr
8U77 1.93 Å, Crystal structure of Taf14 in complex with Yng1
6MIP 2.0 Å, Crystal structure of Taf14 YEATS domain G82A mutant
7F4A 2.0 Å, Crystal structure of Taf14 YEATS domain in complex with H3K9bz peptide
5IOK 2.22 Å, Crystal structure of Taf14 YEATS domain in complex with histone H3K9cr
9VKW 3.13 Å, Cryo-EM structure of the NuA3 complex bound to Ace-coenzyme A
9UUS 3.2 Å, The NuA3 histone acetyltransferase complex bound to acetyl-CoA and H3 tail
9UUO 3.68 Å, The NuA3 histone acetyltransferase complex

Browse structure collections

About this viewer

MolViewer shows 5D7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.