5D8E: SSB from homo sapiens

crystal structure of SSB from homo sapiens. Determined by X-ray diffraction at 3.0 Å resolution. Released 17 Aug 2016.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,235
Mol. weight: 52.08 kDa
Released: 17 Aug 2016

Explore 5D8E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5D8E contains 3 α-helices and 31 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 6 β-strands

Element	Residues	Length	Sheet
β-strand	19-31	13	1
β-strand	37-45	9	1
β-strand	48-55	8	1
α-helix	59-61	3
β-strand	67-78	12	1
β-strand	81-96	16	1
β-strand	100-104	5	1

Chain B: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	17	1	1
β-strand	21-26	6	1
α-helix	27-29	3
β-strand	31	1	2
β-strand	37	1	2
β-strand	38-44	7	1
β-strand	51-55	5	1
β-strand	66-77	12	1
β-strand	82-104	23	1

Chain C: 1 helix, 7 β-strands

Element	Residues	Length	Sheet
β-strand	17-31	15	3
β-strand	37-44	8	3
β-strand	50-55	6	3
β-strand	66-78	13	3
β-strand	81-85	5	3
β-strand	92-97	6	3
β-strand	100-104	5	1
α-helix	105-107	3

Chain D: 0 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	17-26	10	4
β-strand	31	1	5
β-strand	37	1	5
β-strand	38-44	7	4
β-strand	50-55	6	4
β-strand	66-73	8	4
β-strand	75-77	3	4
β-strand	82-84	3	4
β-strand	91-97	7	4
β-strand	98-104	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SOSS complex subunit B1	A, B, C, D	protein	115	Homo sapiens	Q9BQ15 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5D8E_1 SOSS complex subunit B1 (chains A, B, C, D)
MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGN
LIQPGDIIRMTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSHHHHHH

Primary citation

crystal structure of SSB from homo sapiens. Li, Y.H., Gao, Z.Q., Dong, Y.H. To be published.

Other PDB entries of the same protein (UniProt Q9BQ15 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OWT 2.0 Å, Structural basis of SOSS1 complex assembly
4OWW 2.3 Å, Structural basis of SOSS1 in complex with a 35nt ssDNA
4OWX 2.3 Å, Structural basis of SOSS1 in complex with a 12nt ssDNA
5D8F 2.35 Å, crystal structure of SSB and ssDNA complex from homo sapiens
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex

Browse structure collections

About this viewer

MolViewer shows 5D8E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.