5D8F: SSB and ssDNA complex from homo sapiens

crystal structure of SSB and ssDNA complex from homo sapiens. Determined by X-ray diffraction at 2.35 Å resolution. Released 17 Aug 2016.

Method: X-ray diffraction
Resolution: 2.35 Å
Organisms: Homo sapiens, synthetic construct
Chains: 3
Atoms: 1,774
Mol. weight: 28.93 kDa
Released: 17 Aug 2016

Explore 5D8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5D8F contains 3 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	17-31	15	1
β-strand	37-45	9	1
β-strand	48-55	8	1
β-strand	67-78	12	1
β-strand	81-109	29	1

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	17-26	10	1
β-strand	30-31	2	1
β-strand	37-45	9	1
β-strand	48-55	8	1
α-helix	56-61	6
β-strand	67-78	12	1
β-strand	81-85	5	1
β-strand	91-110	20	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SOSS complex subunit B1	A, B	protein	115	Homo sapiens	Q9BQ15 (AlphaFold model)
DNA (5'-d(ptptptptptptptptptpt)-3')	C	DNA	10	synthetic construct

Sequence of entity 1 (A, B), FASTA

>5D8F_1 SOSS complex subunit B1 (chains A, B)
MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGN
LIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSHHHHHH

Sequence of entity 2 (C), FASTA

>5D8F_2 DNA (5'-D(P*TP*TP*TP*TP*TP*TP*TP*TP*TP*T)-3') (chains C)
TTTTTTTTTT

Primary citation

crystal structure of SSB and ssDNA complex from homo sapiens. Li, Y.H., Gao, Z.Q., Dong, Y.H. To be published.

Other PDB entries of the same protein (UniProt Q9BQ15 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4OWT 2.0 Å, Structural basis of SOSS1 complex assembly
4OWW 2.3 Å, Structural basis of SOSS1 in complex with a 35nt ssDNA
4OWX 2.3 Å, Structural basis of SOSS1 in complex with a 12nt ssDNA
5D8E 3.0 Å, crystal structure of SSB from homo sapiens
8RBZ 3.7 Å, Structure of Integrator-PP2A-SOSS-CTD post-termination complex

Browse structure collections

About this viewer

MolViewer shows 5D8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.