Crystal Structure of human transthyretin (TTR) processed with the CrystalDirect automated mounting and cryo-cooling technology. Determined by X-ray diffraction at 1.2 Å resolution. Released 13 Apr 2016.
Explore 5DWP in 3D Show helices and sheets RCSB PDB PDBe
5DWP contains 2 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-18 | 7 | 1 |
| β-strand | 23-24 | 2 | 1 |
| β-strand | 29-35 | 7 | 2 |
| β-strand | 41-48 | 8 | 2 |
| β-strand | 54-55 | 2 | 1 |
| β-strand | 67-73 | 7 | 2 |
| α-helix | 75-81 | 7 | |
| β-strand | 88-90 | 3 | 3 |
| β-strand | 91-97 | 7 | 2 |
| β-strand | 99 | 1 | 4 |
| β-strand | 101 | 1 | 4 |
| β-strand | 104-112 | 9 | 1 |
| β-strand | 115-123 | 9 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-18 | 7 | 1 |
| β-strand | 23-24 | 2 | 1 |
| β-strand | 29-35 | 7 | 3 |
| β-strand | 41-48 | 8 | 3 |
| β-strand | 54-55 | 2 | 1 |
| β-strand | 67-73 | 7 | 3 |
| α-helix | 75-82 | 8 | |
| β-strand | 88-90 | 3 | 2 |
| β-strand | 91-97 | 7 | 3 |
| β-strand | 104-111 | 8 | 1 |
| β-strand | 115-123 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transthyretin | A, B | protein | 116 | Homo sapiens | P02766 (AlphaFold model) |
>5DWP_1 Transthyretin (chains A, B) CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIY KVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP
Automated harvesting and processing of protein crystals through laser photoablation. Zander, U., Hoffmann, G., Cornaciu, I. et al. Acta Crystallogr D Struct Biol (2016) 72:454-466. DOI 10.1107/S2059798316000954 · PubMed
Other PDB entries of the same protein (UniProt P02766 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5DWP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.