5DZD: WW4 domain of ITCH

Crystal Structure of WW4 domain of ITCH in complex with TXNIP peptide. Determined by X-ray diffraction at 1.57 Å resolution. Released 14 Oct 2015.

Method: X-ray diffraction
Resolution: 1.57 Å
Organism: Homo sapiens
Chains: 4
Atoms: 897
Mol. weight: 13.73 kDa
Released: 14 Oct 2015

Explore 5DZD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5DZD contains 5 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
α-helix	479-481	3
β-strand	484-488	5	1
β-strand	494-498	5	1
β-strand	503-505	3	1
β-strand	508	1	2
β-strand	513	1	2

Chain B: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
α-helix	479-481	3
β-strand	484-488	5	3
β-strand	494-498	5	3
β-strand	503-505	3	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	334-337	4

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	330-333	4
α-helix	334-337	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase Itchy homolog	A, B	protein	47	Homo sapiens	Q96J02 (AlphaFold model)
Thioredoxin-interacting protein	C, D	protein	14	Homo sapiens	Q9H3M7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5DZD_1 E3 ubiquitin-protein ligase Itchy homolog (chains A, B)
GRRASVELNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKS

Sequence of entity 2 (C, D), FASTA

>5DZD_2 Thioredoxin-interacting protein (chains C, D)
XTPEAPPCYMDVIX

Primary citation

Crystal Structure of WW4 domain of ITCH in complex with TXNIP peptide. Liu, Y., Tempel, W., Dong, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q96J02 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CQ2 1.4 Å, Crystal Structure of tandem WW domains of ITCH in complex with TXNIP peptide
5DWS 1.65 Å, Crystal Structure of ITCH WW3 domain in complex with TXNIP peptide
5SXP 1.65 Å, Structural basis for the interaction between itch prr and beta-pix
2NQ3 1.8 Å, Crystal structure of the C2 Domain of Human Itchy Homolog E3 Ubiquitin Protein Ligase
2P4R 2.0 Å, Structural basis for a novel interaction between AIP4 and beta-PIX
4ROF 2.03 Å, Crystal Structure of WW3 domain of ITCH in complex with TXNIP peptide
3TUG 2.27 Å, Crystal structure of the HECT domain of ITCH E3 ubiquitin ligase
5C7M 3.03 Å, Crystal structure of E3 ligase itch with a ub variant
2DMV Solution structure of the second ww domain of Itchy homolog E3 ubiquitin protein ligase…
2KYK The sandwich region between two LMP2A PY motif regulates the interaction between…
2YSF Solution structure of the fourth WW domain from the human E3 ubiquitin-protein ligase…

Browse structure collections

About this viewer

MolViewer shows 5DZD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.