5E8G: PDB entry 5E8G

Crystal structure of the DNA binding domain of human transcription factor FLI1. Determined by X-ray diffraction at 2.7 Å resolution. Released 9 Dec 2015.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,104
Mol. weight: 60.02 kDa
Ligands: CO
Released: 9 Dec 2015

Explore 5E8G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5E8G contains 20 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	283-291	9
α-helix	294-296	3
β-strand	301-302	2	1
β-strand	308-310	3	1
α-helix	314-324	11
α-helix	332-344	13
β-strand	348-350	3	1
β-strand	357-360	4	1
α-helix	362-368	7

Chain D: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	283-292	10
α-helix	294-296	3
β-strand	301-302	2	4
β-strand	308-310	3	4
α-helix	314-324	11
α-helix	332-344	13
β-strand	348-350	3	4
β-strand	357-360	4	4
α-helix	362-368	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Friend leukemia integration 1 transcription factor	A, B, C, D	protein	128	Homo sapiens	Q01543 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5E8G_1 Friend leukemia integration 1 transcription factor (chains A, B, C, D)
GPHMPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMN
YDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPTESSMYKYPSDISYMPSY
HAHQQKVN

Ligands and cofactors

ID	Name	Formula	Copies
CO	Cobalt (II) ion	Co	4

Primary citation

Structural Basis for Dimerization and DNA Binding of Transcription Factor FLI1. Hou, C., Tsodikov, O.V. Biochemistry (2015) 54:7365-7374. DOI 10.1021/acs.biochem.5b01121 · PubMed

Other PDB entries of the same protein (UniProt Q01543 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CP6 1.66 Å, Crystal structure of the DNA binding domain of FLI1 (residues 259-371)
9MX9 2.55 Å, Crystal structure of the DNA binding domain of FLI1 (F362A) in complex with a DNA…
9MXA 2.59 Å, Crystal structure of the DNA binding domain of FLI1 (wild-type) in complex with a DNA…
5JVT 3.1 Å, Crystal structure of the DNA binding domain of transcription factor FLI1 in complex with…
9MX8 3.15 Å, Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing…
9MWY 3.28 Å, Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing…
5E8I 3.45 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
6VG2 3.9 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
6VGD 4.2 Å, Crystal structure of the DNA binding domain (DBD) of human FLI1 and the complex of the…
6VG8 4.31 Å, Crystal structure of the DNA binding domains of human FLI1 and Runx2 in complex with…
1FLI DNA-binding domain of fli-1
1X66 Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1…

Browse structure collections

About this viewer

MolViewer shows 5E8G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.