9MWY: DNA binding domain of FLI1

Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing four contiguous GGAA sites. Determined by X-ray diffraction at 3.28 Å resolution. Released 12 Mar 2025.

Method: X-ray diffraction
Resolution: 3.28 Å
Organisms: Homo sapiens, synthetic construct
Chains: 6
Atoms: 4,115
Mol. weight: 82.25 kDa
Released: 12 Mar 2025

Explore 9MWY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9MWY contains 21 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	283-291	9
β-strand	300-301	2	1
β-strand	309-311	3	1
α-helix	314-324	11
α-helix	332-340	9
α-helix	342-345	4
β-strand	348-350	3	1
β-strand	357-360	4	1
α-helix	362-367	6

Chain C: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	283-292	10
α-helix	294-296	3
β-strand	301-302	2	3
β-strand	308-310	3	3
α-helix	314-324	11
α-helix	332-345	14
β-strand	348-350	3	3
β-strand	357-360	4	3
α-helix	363-369	7

Chain D: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	283-292	10
α-helix	294-296	3
β-strand	300-302	3	2
β-strand	308-311	4	2
α-helix	314-324	11
α-helix	332-339	8
β-strand	348-350	3	2
β-strand	357-360	4	2
α-helix	362-369	8

Chain L: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	283-287	5
α-helix	289-292	4
α-helix	294-296	3
β-strand	300-302	3	4
β-strand	308	1	5
β-strand	309-311	3	4
α-helix	314-325	12
α-helix	332-339	8
β-strand	348-350	3	5
β-strand	358-360	3	5
α-helix	362-365	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Friend leukemia integration 1 transcription factor	A, C, D, L	protein	145	Homo sapiens	Q01543 (AlphaFold model)
25-mer DNA containing four contiguous GGAA sites, bottom strand	G	DNA	25	synthetic construct
25-mer DNA containing four contiguous GGAA sites, top strand	H	DNA	25	synthetic construct

Sequence of entity 1 (A, C, D, L), FASTA

>9MWY_1 Friend leukemia integration 1 transcription factor (chains A, C, D, L)
GPHMQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDP
DEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDAHGIAQALQPHPT
ESSMYKYPSDISYMPSYHAHQQKVN

Sequence of entity 2 (G), FASTA

>9MWY_2 25-mer DNA containing four contiguous GGAA sites, bottom strand (chains G)
GACCGGAAGGAAGGAAGGAAGTGCG

Sequence of entity 3 (H), FASTA

>9MWY_3 25-mer DNA containing four contiguous GGAA sites, top strand (chains H)
CGCACTTCCTTCCTTCCTTCCGGTC

Primary citation

Structure and cooperative formation of a FLI1 filament on contiguous GGAA DNA sites. Hou, C., Tsodikov, O.V. Nucleic Acids Res (2025) 53. DOI 10.1093/nar/gkaf205 · PubMed

Other PDB entries of the same protein (UniProt Q01543 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9CP6 1.66 Å, Crystal structure of the DNA binding domain of FLI1 (residues 259-371)
9MX9 2.55 Å, Crystal structure of the DNA binding domain of FLI1 (F362A) in complex with a DNA…
9MXA 2.59 Å, Crystal structure of the DNA binding domain of FLI1 (wild-type) in complex with a DNA…
5E8G 2.7 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1
5JVT 3.1 Å, Crystal structure of the DNA binding domain of transcription factor FLI1 in complex with…
9MX8 3.15 Å, Crystal structure of the DNA binding domain of FLI1 in complex with a DNA containing…
5E8I 3.45 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
6VG2 3.9 Å, Crystal structure of the DNA binding domain of human transcription factor FLI1 in…
6VGD 4.2 Å, Crystal structure of the DNA binding domain (DBD) of human FLI1 and the complex of the…
6VG8 4.31 Å, Crystal structure of the DNA binding domains of human FLI1 and Runx2 in complex with…
1FLI DNA-binding domain of fli-1
1X66 Solution structure of the SAM_PNT-domain of the human friend LEUKEMIAINTEGRATION 1…

Browse structure collections

About this viewer

MolViewer shows 9MWY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.