Crystal structure of the DNA binding domain of FLI1 (residues 259-371). Determined by X-ray diffraction at 1.66 Å resolution. Released 12 Mar 2025.
Explore 9CP6 in 3D Show helices and sheets RCSB PDB PDBe
9CP6 contains 7 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 283-291 | 9 | |
| α-helix | 294-296 | 3 | |
| β-strand | 301-302 | 2 | 1 |
| β-strand | 308-310 | 3 | 1 |
| α-helix | 314-325 | 12 | |
| α-helix | 332-341 | 10 | |
| α-helix | 343-345 | 3 | |
| β-strand | 348-350 | 3 | 1 |
| α-helix | 351 | 1 | |
| β-strand | 357-360 | 4 | 1 |
| α-helix | 362-368 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Friend leukemia integration 1 transcription factor | A | protein | 117 | Homo sapiens | Q01543 (AlphaFold model) |
>9CP6_1 Friend leukemia integration 1 transcription factor (chains A) GPHMQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDP DEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP
Structure and cooperative formation of a FLI1 filament on contiguous GGAA DNA sites. Hou, C., Tsodikov, O.V. Nucleic Acids Res (2025) 53. DOI 10.1093/nar/gkaf205 · PubMed
Other PDB entries of the same protein (UniProt Q01543 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9CP6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.