Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 6.5. Determined by X-ray diffraction at 1.16 Å resolution. Released 9 Nov 2016.
Explore 5ECA in 3D Show helices and sheets RCSB PDB PDBe
5ECA contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 85-88 | 4 | 1 |
| β-strand | 92 | 1 | 2 |
| β-strand | 99 | 1 | 1 |
| β-strand | 102 | 1 | 2 |
| β-strand | 107-112 | 6 | 1 |
| β-strand | 118-123 | 6 | 1 |
| β-strand | 129-133 | 5 | 1 |
| α-helix | 134-136 | 3 | |
| β-strand | 137-139 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Proto-oncogene tyrosine-protein kinase Src | A | protein | 60 | Gallus gallus | P00523 (AlphaFold model) |
>5ECA_1 Proto-oncogene tyrosine-protein kinase Src (chains A) SHMTFVALYDYVASGETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPSD
Crystal structure of a chimeric c-Src-SH3 domain with the sequence of the RT-loop from the Abl-SH3 domain at pH 6.5. Camara-Artigas, A. To be published.
Other PDB entries of the same protein (UniProt P00523 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ECA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.