Crystal structure of the winged helix domain in Chromatin assembly factor 1 subunit p90. Determined by X-ray diffraction at 2.75 Å resolution. Released 16 Mar 2016.
Explore 5EJO in 3D Show helices and sheets RCSB PDB PDBe
5EJO contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 527-537 | 11 | |
| α-helix | 544-554 | 11 | |
| α-helix | 560-570 | 11 | |
| β-strand | 571-573 | 3 | 1 |
| α-helix | 574-576 | 3 | |
| β-strand | 584-586 | 3 | 1 |
| α-helix | 589-598 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromatin assembly factor 1 subunit p90 | A | protein | 94 | Saccharomyces cerevisiae S288c | Q12495 (AlphaFold model) |
>5EJO_1 Chromatin assembly factor 1 subunit p90 (chains A) GPLGSMKQKAMITDPMDLLRLFDGVQDSTFSLGTVTEIAQKNLPQYNKQTIKNTIKEYAI RSSGKGDLPRKWVIKDAQNWENLRANANMPTPSL
A DNA binding winged helix domain in CAF-1 functions with PCNA to stabilize CAF-1 at replication forks. Zhang, K., Gao, Y., Li, J. et al. Nucleic Acids Res (2016) 44:5083-5094. DOI 10.1093/nar/gkw106 · PubMed
Other PDB entries of the same protein (UniProt Q12495 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5EJO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.