5EWX: PDB entry 5EWX

Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with chemical cross-linker EY-CBS. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Mar 2016.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Enterobacteria phage T4, Staphylococcus aureus
Chains: 2
Atoms: 3,472
Mol. weight: 51.47 kDa
Ligands: EYC
Released: 30 Mar 2016

Explore 5EWX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5EWX contains 26 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
β-strand	14-15	2	1
β-strand	16	1	2
β-strand	17-19	3	1
β-strand	25-28	4	1
β-strand	31-32	2	1
α-helix	1220-1228	9
α-helix	1235-1247	13
α-helix	1249-1251	3
α-helix	1252-50	28
β-strand	57	1	2
α-helix	60-80	21
α-helix	85-90	6
α-helix	93-111	19
α-helix	115-122	8
α-helix	126-134	9
α-helix	137-141	5
α-helix	143-155	13
α-helix	159-161	3

Chain B: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-10	8
β-strand	14-15	2	3
β-strand	16	1	4
β-strand	17-19	3	3
β-strand	25-28	4	3
β-strand	31-32	2	3
α-helix	1220-1227	8
α-helix	1235-1247	13
α-helix	1249-1251	3
α-helix	1252-50	28
β-strand	57	1	4
α-helix	60-80	21
α-helix	85-90	6
α-helix	93-111	19
α-helix	115-122	8
α-helix	126-134	9
α-helix	137-141	5
α-helix	143-155	13
α-helix	159-161	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Endolysin,Immunoglobulin G-binding protein A,Endolysin	A, B	protein	227	Enterobacteria phage T4, Staphylococcus aureus	P00720, P38507 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5EWX_1 Endolysin,Immunoglobulin G-binding protein A,Endolysin (chains A, B)
MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKGGGGSGGGGSVDNKFNKEQQNAFYE
ILHLPNLNEEQRNAFIQSLKDDPSQSANLLACAKAANDAQSLCAAKSELDKAIGRNTNGV
ITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNS
LRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYANL

Ligands and cofactors

ID	Name	Formula	Copies
EYC	2,2'-ethyne-1,2-diylbis{5-[(chloroacetyl)amino]benzenesulfonic acid}	C18 H14 Cl2 N2 O8 S2	2

Primary citation

Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker. Jeong, W.H., Lee, H., Song, D.H. et al. Nat Commun (2016) 7:11031-11031. DOI 10.1038/ncomms11031 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 5EWX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.