N184K pathological variant of gelsolin domain 2 (trigonal form). Determined by X-ray diffraction at 1.7 Å resolution. Released 5 Oct 2016.
Explore 5FAE in 3D Show helices and sheets RCSB PDB PDBe
5FAE contains 5 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 161-166 | 6 | 1 |
| β-strand | 172-176 | 5 | 1 |
| α-helix | 180-182 | 3 | |
| β-strand | 188-192 | 5 | 1 |
| β-strand | 196-201 | 6 | 1 |
| α-helix | 207-219 | 13 | |
| α-helix | 220-224 | 5 | |
| β-strand | 230-235 | 6 | 1 |
| α-helix | 241-247 | 7 | |
| α-helix | 250-254 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gelsolin | A | protein | 119 | Homo sapiens | P06396 (AlphaFold model) |
>5FAE_1 Gelsolin (chains A) GSHHVVPNEVVVQRLFQVKGRRVVRATEVPVSWESFKNGDCFILDLGNNIHQWCGSNSNR YERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAA
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (CL, PEG, SO4) are not listed.
Molecular basis of a novel renal amyloidosis due to N184K gelsolin variant. Boni, F., Milani, M., Porcari, R. et al. Sci Rep (2016) 6:33463-33463. DOI 10.1038/srep33463 · PubMed
Other PDB entries of the same protein (UniProt P06396 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5FAE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.