6LJF: Gelsolin G3 domain

Crystal structure of gelsolin G3 domain (calcium condition). Determined by X-ray diffraction at 1.5 Å resolution. Released 1 Jan 2020.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,930
Mol. weight: 22.78 kDa
Ligands: CA
Released: 1 Jan 2020

Explore 6LJF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LJF contains 12 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	272-277	6	1
β-strand	284-289	6	1
β-strand	294	1	2
α-helix	295	1
α-helix	296-298	3
β-strand	304-309	6	1
α-helix	310-312	3
β-strand	314-319	6	1
α-helix	325-341	17
α-helix	350	1
β-strand	351-354	4	1
α-helix	360-363	4
β-strand	366	1	2

Chain B: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	272-277	6	3
β-strand	284-289	6	3
β-strand	294	1	4
α-helix	295	1
α-helix	296-298	3
β-strand	304-309	6	3
α-helix	310-312	3
β-strand	314-319	6	3
α-helix	325-341	17
α-helix	348	1
β-strand	349-354	6	3
α-helix	360-363	4
β-strand	366	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gelsolin	A, B	protein	101	Homo sapiens	P06396 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6LJF_1 Gelsolin (chains A, B)
LAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERK
AALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFKNWR

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Novel inter-domain Ca2+-binding site in the gelsolin superfamily protein fragmin. Takeda, S., Fujiwara, I., Sugimoto, Y. et al. J Muscle Res Cell Motil (2020) 41:153-162. DOI 10.1007/s10974-019-09571-5 · PubMed

Other PDB entries of the same protein (UniProt P06396 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FAF 1.05 Å, N184K pathological variant of gelsolin domain 2 (orthorhombic form)
6QW3 1.3 Å, Calcium-bound gelsolin domain 2
6LJE 1.4 Å, Crystal structure of gelsolin G3 domain (calcium and magnesium condition)
2FH1 1.55 Å, C-terminal half of gelsolin soaked in low calcium at pH 4.5
3CIP 1.6 Å, Complex of Dictyostelium Discoideum Actin with Gelsolin
1KCQ 1.65 Å, Human Gelsolin Domain 2 with a Cd2+ bound
3CI5 1.7 Å, Complex of Phosphorylated Dictyostelium Discoideum Actin with Gelsolin
5FAE 1.7 Å, N184K pathological variant of gelsolin domain 2 (trigonal form)
5O2Z 1.7 Å, Domain swap dimer of the G167R variant of gelsolin second domain
1D4X 1.75 Å, Crystal Structure of Caenorhabditis Elegans Mg-ATP Actin Complexed with Human Gelsolin…
1NLV 1.8 Å, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca ATP And Human…
1NM1 1.8 Å, Crystal Structure of D. Dicsoideum Actin Complexed With Gelsolin Segment 1 and Mg ATP at…

Browse structure collections

About this viewer

MolViewer shows 6LJF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.