5FG5: Bromodomain of human BRPF1

Crystal structure of the bromodomain of human BRPF1 in complex with PFI-4 chemical probe. Determined by X-ray diffraction at 1.5 Å resolution. Released 30 Dec 2015.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,183
Mol. weight: 28.23 kDa
Ligands: 5XF
Released: 30 Dec 2015

Explore 5FG5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FG5 contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	631-646	16
α-helix	665-668	4
α-helix	675-683	9
α-helix	690-707	18
α-helix	713-737	25

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	630-646	17
α-helix	665-667	3
α-helix	675-683	9
α-helix	690-707	18
α-helix	713-735	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peregrin	A, B	protein	116	Homo sapiens	P55201 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FG5_1 Peregrin (chains A, B)
SMEMQLTPFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEA
YRYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMG

Ligands and cofactors

ID	Name	Formula	Copies
5XF	~{N}-(1,3-dimethyl-2-oxidanylidene-6-pyrrolidin-1-yl-benzimidazol-5-yl)-2-metho…	C21 H24 N4 O3	2

Water and common crystallization additives (NO3) are not listed.

Primary citation

Crystal structure of the bromodomain of human BRPF1 in complex with PFI-4 chemical probe. Tallant, C., Owen, D.R., Gerstenberger, B.S. et al. To be published.

Other PDB entries of the same protein (UniProt P55201 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5MWZ 1.25 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ073
3L42 1.3 Å, PWWP domain of human bromodomain and PHD finger containing protein 1
5C6S 1.3 Å, Human Bromodomain and PHD Finger Containing 1, PWWP domain in complex with XST005904a
5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
5O5F 1.3 Å, Crystal structure of the human BRPF1 bromodomain in complex with BZ038
5ETB 1.33 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED13
5D7X 1.35 Å, Crystal structure of the human BRPF1 bromodomain in complex with XZ08
7C4I 1.37 Å, High resolution structure of BRPF1 Bromo Domain from Biortus
5EM3 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED9
5ETD 1.4 Å, Crystal structure of the human BRPF1 bromodomain in complex with SEED14
8QAZ 1.4 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…
8QB2 1.42 Å, Crystal Structure of BRPF1 bromodomain in complex with acetyl-pyrrole derivative…

Browse structure collections

About this viewer

MolViewer shows 5FG5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.